Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR8G14 Olfactory Receptor

Gene Symbol Modo-OR8G14
Organism Opossum
Family 8
Subfamily G
Pseudo No
Location scaffold_18622:0-49517 (-)

Sequence information


Nucleotide sequence

CATCCAGAAAATGGAAATCAAACTTCAGTGACTGAGTTTATCATTGCAGGCTTATCAGAC
CAACCAGAGCTACAGATTCCCCTTTTTTTGCTGTTCTTTGGGATTTATGTGGTCACCGTG
CTAGGAAACCTAGGGATAATCATATTGATTGGCCTCAGTTCCAACCTTCACACCCCCATG
TACTATTTTCTCAGTTGTCTGTCCTTCATTGACTTCTGCCAGTCCACTGTCATCACTCCC
AAAATGTTTGTGAACTTTGTGTCAGAGAAGAACATCATCTCCTACTCTGAGTGCATGGTC
CAGCTCTATTTTTTCCTCATTTTTATAATTTCTGAGTGCCATATGTTGGCAGTGATGGCA
TATGACCGCTATGTTGCCATCTGTAGCCCTCTGCTCTATAATGTCATCATGTCCTATCAC
ATGTGCTCCCAGTTGCTGGGTGGAGTAGTTGCTATGGGTGTGATTGGTGCCACAGTTCAC
ACAGGTTGCATTCTTAGAGTTTACTTCTGCAAGGACAATATTGTCAATAATTTCTTTTGT
GATCTTCTTCCCCTGTTCAAGCTCTCTTGCTCTGACACCTATATCAATGAAGTAGTGCTT
CTGGCTTTCTGTTCATTTAACCTTTTTCTTCCAACTGTAACCATTGTTAGTTCTTATGTT
TTCATCCTCTTCAGCATACTCCGTATCCAGTCCACTGCTGGCAGATCTAAAGCCTTCAGT
ACTTGCAGTTCCCATATCATGGCTGTTTCTCTATTCTTTGGCTCTACCGCATACATGTAT
CTTCAGCCTTCTACCAACTCCAAGGACCAGAGGAAAGTGTCCTCCGTGTTTTATACCATA
GTTATCCCCATGCTGAACCCCCTGATCTATAGCCTCAGGAATAAAGATGTCAAAATTGCA
CTGAAGAAAATCCTAGGGAAAAGAGTGTTTTCA


Conceptual translation

HPENGNQTSVTEFIIAGLSDQPELQIPLFLLFFGIYVVTVLGNLGIIILIGLSSNLHTPM
YYFLSCLSFIDFCQSTVITPKMFVNFVSEKNIISYSECMVQLYFFLIFIISECHMLAVMA
YDRYVAICSPLLYNVIMSYHMCSQLLGGVVAMGVIGATVHTGCILRVYFCKDNIVNNFFC
DLLPLFKLSCSDTYINEVVLLAFCSFNLFLPTVTIVSSYVFILFSILRIQSTAGRSKAFS
TCSSHIMAVSLFFGSTAYMYLQPSTNSKDQRKVSSVFYTIVIPMLNPLIYSLRNKDVKIA
LKKILGKRVFS