Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR8K15P Olfactory Receptor

Gene Symbol Modo-OR8K15P
Organism Opossum
Family 8
Subfamily K
Pseudo Yes
Location scaffold_18549:0-1,756,230 (-)

Sequence information


Nucleotide sequence

ATGGGCATCACAAATCGTCCTGAGCTGAAGGAACCTCTCTTTGTTCTCTTTTTACTCAAC
TACATGGCCATAGTTCTTGGGAACCTGAGTCTGATCATCATAACTAGCATTGACTCCCAC
CTCCAAACCCCAATGTACTTTTTTCTCAGGCATCTGGCATTTGTGGATCTGGGATATTCC
ACGGCTATTGGTCCAAAAATGCTGGTTAGTTTCATAGAGGAGAAAAACTATCATTTCCTT
TTATGAATGTGCAATACAATTAGGATTTGTTATAATATTTATCAACACTGAATTTTTTAT
CTTGTCAGCCATGGCCTATGACCGTTATGTGGCTATCTGTAAGCCCCTCCTGTACATGGT
CATCATGTCACAAAGACTATGTTGGACCTTGATGGCTGTCTCATACCTCTATAGTATCAT
GGCATCCCTACTGGCCACAATAAAGATTTTTAAATCATCTTTCTGCAAATCGAACTTATT
AAGGAATTTCTATTGTAACAGCCTCCCTATTTTGTCTATTATGTGTTCAGACACAAGTGA
GATAGAACTAATCATCAAGACATTTTGGCATACTGAATTTGATTCCTTCCCTCTTGATAT
ATCCTTTTCTCCTATATGCTTATTCTTGTGGCCATCTTCAGGATGAACTCTTCTGAGGGC
CGGAATAAAGCCTTTTCTACCTGTGGCTCTCATCTCACTGTGGTGGTTGTGTTCTATGGA
ACACTTATTTTCCATGTTCCTACAGCCACAATCTAAGCGTTCCTTTGACACAAACCAGGT
GGTCTCTGTATTTTATACCCTGGTCATCCCCATGCTCAACCCATTGATCTATAGCTTGAG
GAACAAAGATGTGAAAAGTGCCTTGAAAAGACTCTTTATAAAA


Conceptual translation

MGITNRPELKEPLFVLFLLNYMAIVLGNLSLIIITSIDSHLQTPMYFFLRHLAFVDLGYS
TAIGPKMLVSFI\RKTIISFYECAIQLGFVIIFINTEFFILSAMAYDRYVAICKPLLYM
VIMSQRLCWTLMAVSYLYSIMASLLATIKIFKSSFCKSNLLRNFYCNSLPILSIMCSDTS
EIELIIK/ILAY*I*FLPS*YILFSYMLILVAIFRMNSSEGRNKAFSTCGSHLTVVVVF
YGTLIF\FLQPQSKRSFDTNQVVSVFYTLVIPMLNPLIYSLRNKDVKSALKRLFIK