Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR8V17 Olfactory Receptor

Gene Symbol Modo-OR8V17
Organism Opossum
Family 8
Subfamily V
Pseudo No
Location scaffold_18549:0-1,808,170 (-)

Sequence information


Nucleotide sequence

ATGGAAGAAATCAAGTTTAATGAAACCACTGGGAGTCAGGCGACTGAATTCATTCTCATG
GGCATCACAAACCGTCCTGAGCTTCAAGGACCCCTCTTTGTTGTATTTTTCTTCAACTAC
ATGGCCATAGCACTGGGAAATCTGGGGCTTATCATCCTAACCACTTTTGATTCTCACCTT
CAAACTCCCATGTATTATTTTATCAGACATCTGGCATTTGTGGATCTTGGCTATTCCACA
GCAGTTGGTCCAAAAATGCTAGTTAGTTTCATAGAAAAGAAAAATATCATTTCTTATTAT
GGATGTGCAATACAGCTATTTTTTATTGTGATATTTCTCACCAGTGAATTTTTCAATCTG
TCCGCCATGGCTGTAGATCGCTATGTGGCTATCTGTAAGCCCCTTCTCTATATGGTCATC
ATGTCTGACCGGGTATGTTGGATTTCAGTGGTTATCTCATATGTTTATAGTATTATATTA
GCACTACTGGTCACCATAAAGATTTTCCAATCATCTTTTTGTAAGTCAAATGTATTAAGA
TATTTCTACTGTGACAGTCTACTTCTAGTGTCCATTATATGCTCAGATACAAGTGAAATT
GAACTAATCATTATGACATTTGCTGCACTTAATATGGTTTCTTCACTCTTCATTATTCTT
GTCTCCTACATGCTTATTCTTGTAGCCATTCTCAGAATGAACTCTTCTGAGGGCAGGCAA
AAAGCTTTCTCTACCTGTGGCTCTCATCTCACAGTTGTGGTTGTGTTCTATGGAACACTT
CTCTTCATGTACCTGCAGCCTCATTCTAGCCATTCTTTTGACACAGACAAGATGGCATCT
GTGTTTTACACTTTAGTCATCCCCATGCTTAATCCTTTGATCTACAGTTTGAGGAATAAG
GAAGTGAAAGATGCCTTGAAAAGACTCATTAAAAAATTGATGCAAACACTGTCTTTCATG
ACCAATGTAAAA


Conceptual translation

MEEIKFNETTGSQATEFILMGITNRPELQGPLFVVFFFNYMAIALGNLGLIILTTFDSHL
QTPMYYFIRHLAFVDLGYSTAVGPKMLVSFIEKKNIISYYGCAIQLFFIVIFLTSEFFNL
SAMAVDRYVAICKPLLYMVIMSDRVCWISVVISYVYSIILALLVTIKIFQSSFCKSNVLR
YFYCDSLLLVSIICSDTSEIELIIMTFAALNMVSSLFIILVSYMLILVAILRMNSSEGRQ
KAFSTCGSHLTVVVVFYGTLLFMYLQPHSSHSFDTDKMASVFYTLVIPMLNPLIYSLRNK
EVKDALKRLIKKLMQTLSFMTNVK