Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR8V2P Olfactory Receptor

Gene Symbol Modo-OR8V2P
Organism Opossum
Family 8
Subfamily V
Pseudo Yes
Location scaffold_18549:0-1,935,590 (-)

Sequence information


Nucleotide sequence

ATGGATAATTGGAATGAAACTAAATGGACTCGAGTAACTGAATTCATTCTCAGGGGCATC
ACAGATTTTCCTGAACTGCAGATTCCCCTCTTTATAGTGTTCCTCATCATCTACACAGTG
ACAGCTCTGGGTAATCTGGGTCTGATTATCTTGACCAAAATTGATTCTCGTCTGAAAACT
CCTATGTACTTTTTCCTCAGGAATCTGGCGTTTATTGATCTTGGGTACTCCACTGCTATT
GGACCAAAAATGTTGGGTAATTTTTGTAATGGAGAGAAATACGATCTCCTATGCTGGATG
TGCAACCCAGCTAGTTGTCTTTATAACATTCATTATAAGTGAACTTTTTATGCTCTCCGT
GATGGCTTATGACCGCTATGTAGCCATCTGTAACCCTCTGCTCTACATGGTCATCATGTC
AGACAGATTGTGCTGTCTTTTGGTGGCCATCCCATACCTCTACAGTACCTCCCTAGCACT
GGTGACCACAATTAAGATTTTTAATTCATCTTCTTGGAAATCTAATGTAATTAGTCATTT
CTACTGTGATAGTCTTCCCCTATTAAGTATTTTATGGAATGATGCAAAGGATGTGGAGTT
AATAATTCTGAGTCTTTCTGCTGTTAATTTAGTTTCTTCACTGCTAGTTGTTCTTCTTTC
ATATGCTCTCATTCTTGTGGCCATTCTCAGGATGAACTCTGCTGAAGGCAGACGCAAAGC
TTTCTCCACCTGTGGCTCCCATCTCACAGTGGTGGTTGTATTCTATTCAACACTAACTTT
TATGTACTTGCAGCCCAAGTCTAGTCACTCCTTTGACACAGATAAAATGGCTTCTGTCTT
TTATACCCTGGTCATTCCCATGCTCAACCCTTTGATCTATAGCTTGAGAAATAAGGAGGT
AAAGGGGGCCTTTGAAGAAAGCTCTAGAAAATCGATTAAAATGTGTTCTTTAATATGCCA
GTTA


Conceptual translation

MDNWNETKWTRVTEFILRGITDFPELQIPLFIVFLIIYTVTALGNLGLIILTKIDSRLKT
PMYFFLRNLAFIDLGYSTAIGPKMLGNF\MERNTISYAGCATQLVVFITFIISELFMLS
VMAYDRYVAICNPLLYMVIMSDRLCCLLVAIPYLYSTSLALVTTIKIFNSSSWKSNVISH
FYCDSLPLLSILWNDAKDVELIILSLSAVNLVSSLLVVLLSYALILVAILRMNSAEGRRK
AFSTCGSHLTVVVVFYSTLTFMYLQPKSSHSFDTDKMASVFYTLVIPMLNPLIYSLRNKE
VKGAFEESSRKSIKMCSLICQL