Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR8Y1P Olfactory Receptor

Gene Symbol Modo-OR8Y1P
Organism Opossum
Family 8
Subfamily Y
Pseudo Yes
Location scaffold_18549:0-1675011 (-)

Sequence information


Nucleotide sequence

GATCATGTCCTTTCAATAGAAGGAACAATCATGTTGAATGACACTATTTTACATGAAGTT
ACTGAATTTATTCTCTTGGGCATCATAAATTGTCCTGAACTGAAGATATTCCTCTTTGTT
GTATTTTTCCTCATCTATATGGCCATTCCTTTAGGAAAATCCTGAGCCTCATCATTCCTA
ATCAGTGTTGATTTCCACTTTCAATTATCCATACATTTTTTTTTCCTCAGGCATCTGGCA
TTTATTGAACTTTGTTATTTTACCACAGTGTGTAAAGAAAAATTGATTATTAGTTTTATA
GAAAGAGAAAAATATAATTTTGTATAACTGATGTGCAATTCATCAAGATTTCTTTGGGAT
ATTTATTGCCAGTGAAATTTTTGCCTTGTCAGTCATGGTTTATGACCACTATGTGGTTAA
CTGTAAGCCCCTCCCACTATATGGTACTCTTGGGAAACAGAAATGTTAGATCTTAGCAGC
TATTTTATACCTTTTAAGCATCATGGTAGATCTACTGATCACAAGAAGCATTTTTGAATT
ATCTTTCTATTAATCAAATGTACTTAGTtgtgaaccttaaaaattctcagaccctacttc
ataaggttggattgtaaaccttaaaaattctcagaccctacttcttaaggttaggttaag
accattccccattttaaacaat


Conceptual translation

DHVLSIEGTIMLNDTILHEVTEFILLGIINCPELKIFLFVVFFLIYMAIPLGKS*ASSFL
ISVDFHFQLSIHFFFLRHLAFIELCYFTTVCKEKLIISFIEREK\ILYN*CAIHQDFFG
IFIASEIFALSVMVYDHYVVNCKPLPLYGTLGKQKC*ILAAILYLLSIMVDLLITRSIFE
LSFY*SNVLSCEP*KFSDPTS*GWIVNLKNSQTLLLKVRLRPFPILNN