Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR8Z1P Olfactory Receptor

Gene Symbol Modo-OR8Z1P
Organism Opossum
Family 8
Subfamily Z
Pseudo Yes
Location scaffold_11989:0-165440 (-)

Sequence information


Nucleotide sequence

AAGAAAAGGAACCAAAAATCCCCATTGGAATTTGTCTTCTTGGGAATCACAGAAGACATT
GCTCAGCAGGGTTCCTTTTTTGGTTTATTCCTTGTTATTTAATTAGTTGCTGTAATAGGG
AACATGGGGTTGATCACCCTGATATAGATCAACTTCTTTTTCCACACCTCCATGTACTTC
TTCCTCATCAGCCTCAACTTCTGCTTCTCCTGTATTACAGTCCTGAAGATATTGGCTGAC
TTCTTGTCAGAACATAGTCAATGGATTCCCATATGTGTGGCACAAATGAAGCCCTTCATC
ATTTTTGCCTTGGCTGAGTGGCCTCCAGGGGATATGACTGCTATGTTGCCATGTGCAGTC
CTTGCTCTATTCTGTCATTGTGTCCTTTGGGTGATTGTGTGCTATGTGGCCTTGTCTCAC
TTTGTGAGTTCTTAATCTTTGCTTTTGGATGTTTCATCCAGATGAGTTCCTTTTCCATCA
TTCTGATCTTCTCTTTGTAGATCATCATTGCCATCCTGAGAATCTGATCAACTGAGGGCA
AGCACAATGCCTTTTCTATTTGTGACTCATCTGACTGCTGTCAGTATGTTTTATGGAACC
ATTATCTTCATGTACTTAGAGCCCTGGAAAAACTAGTTATTCCCTGAACCAGGATTGTGT
GATGATCTCTGTCCTCTGCACTGTGATTATCTCCATGCCAAATACCATTATCTATATTCT
GAAGAACAAGGAGGTGAAGAATATCCTGTGTAAAGTCTAACCTTCGGGCTTG


Conceptual translation

KKRNQKSPLEFVFLGITEDIAQQGSFFGLFLVI*LVAVIGNMGLITLI*INFFFHTSMYF
FLISLNFCFSCITVLKILADFLSEHSQWIPICVAQMKPFIIFALAE/ASRGYDCYVAMC
SPCSILSLCPLGDCVLCGLVSLCEFLIFAFGCFIQMSSFSIILIFSL*IIIAILRI*STE
GKHNAFSIC\HLTAVSMFYGTIIFMYLEPWKN*\SLNQDCVMISVLCTVIISMPNTII
YILKNKEVKNILCKV*PSGL