Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR9G13P Olfactory Receptor

Gene Symbol Modo-OR9G13P
Organism Opossum
Family 9
Subfamily G
Pseudo Yes
Location scaffold_18549:0-800290 (+)

Sequence information


Nucleotide sequence

ATGGAGAAGTTTAACCACACTGTGACTGAATTCATCCTGGTTGGTTTCACCCAGGATCCT
GTGATGCAGCTGGTACTCTTTTTCCTTTTTCTGCATGCGTGTACTCTGTAACAGTGGTGG
GAAACATCACTCTGATAGTGCTAATCTGTACAGACACCCGATTGGCACACCCCCATGTAT
TTCTTCATTGGGAACCTGTCTTTTTTGGATCTCTGGTATTCCACTGTTTATACTCCCAAA
ATCATGGTGAATTGTGTGTCTGAGGATAAGAGCATCTCCTTTGCTGGGTGTGTGGCTCAA
TTTTTATTCTCAGGTGGGCTGGCTTACAGTGAATGCTACTTGTTGGCTGCCATGGCATAT
GACCGCTATATGGCCATCTCCAAACCACTACTCTATGCTCAAGTCATGACTGGCGGGATC
TGTGTGGGTCTTGTAGCAGCTTCATATCTTGGAGCTTTTGTTATCTGTGGCATCTTTACA
CACAAAACATTCACCATGACTTTCTGTGGGGATAATGTTATTAATGACTTCTTTTGTGAT
CTACCACCCCTGGGTAAAGCTGGCATGTGATGTGCAGGCCAATTACCACATTTTCCTTTA
TATTGCATTAACTTTAAATGTCCTTACACCCATCGTGTTCATCTTGGCCTCTTATCTTTT
CATCATTCTTGCCATCTTGAGGATTCGCTCCACTCAGGGTCAGCTTAAAGCCTTCTCTAC
TTGTTCTTCCCACTTAATTTCTGTCACATTGTACTTTGGGTCCCTTCTTTATATATTATT
ATCGTCCCAGTTCCAGCTACTCCCTGCAGCAGGATAAAATTATTGCCTTATCTTACACTG
TGGTCTTCCCCATGTTAAATCCCATGATCTACAGCCTGAGGAACAAGGACGTGAAAGAAG
CTCTGAAGAAACTTTTAAAGATGTCAGCTTCC


Conceptual translation

MEKFNHTVTEFILVGFTQDPVMQLVLFFLFL/CVYSVTVVGNITLIVLICTDT\WHTP
MYFFIGNLSFLDLWYSTVYTPKIMVNCVSEDKSISFAGCVAQFLFSGGLAYSECYLLAAM
AYDRYMAISKPLLYAQVMTGGICVGLVAASYLGAFVICGIFTHKTFTMTFCGDNVINDFF
CDLPPL\KLACDVQANYHIFLYIALTLNVLTPIVFILASYLFIILAILRIRSTQGQLKA
FSTCSSHLISVTLYFGSLLYI\YRPSSSYSLQQDKIIALSYTVVFPMLNPMIYSLRNKD
VKEALKKLLKMSAS