Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-ORUN4 Olfactory Receptor

Gene Symbol Modo-ORUN4
Organism Opossum
Family 0
Subfamily Modo-ORUN4
Pseudo No
Location scaffold_18549:0-1,953,570 (-)

Sequence information


Nucleotide sequence

tttatctgagcagaggagagtgtgactcttgctccaatctactctatgctcaatatattc
attatgcttcaattaattcagtctaatatttcatttacttttggagatattcacataatt
actacatacttatatcgagcatgatttcactaaaatcACCCTTGAGAGCTTAATATTAGG
ATGTGTTTCCTTAGAAGGGATGGATTTATCTGTCTATTTCTCAATAATCATAGATTAAGA
GCCTGCTATAAGTTATTGTCTTTACTACTTCCTGAGTATGAAGTAATGTTGGCCTCATCT
TGCCCTGGCAACCACATTCCTGAAACAGTATCTCTTCCTTCTTTAGCTTCCATTCTTGTA
ATTTCCATTACAATTGTCTTGGTGTCCTACTTCTACATATGCTCTACAGAAGGGAGTCAT
AAAGGCTTCTCCACCTTTACTGACTATATAATGGTTGTTACACGATTTTTGTTTGTTTAT
TATTTTATGGACACTCCTTTTCCTATTCTTTCAGGCCCAGTTAATCATTCACACTGATGA
ATCAGTGTCAATTTTCTATATACTAGCAATCACCATTCTGAATCTTGTGATCTATAATGT
AAAGAACAAGGATGAGTTAGAAGCTCTGAATAGAGTGCTCAACAAGModo-ORUN5ATGG
AAATGACTGGAGAAAATCAGAGCTCAATCTTCAAGTTCCTTGAGTGCCTGCTGAATGCAG
AACGACAAGAGGTTCTCTTTTTGTTGTTCTCTTCGATTGTTCTTATGAGAAAACTGGGTC
CAATTCTGTTATTCCAGATAGGACAGTATATACCCTGTGTTCAGCATTGTTTCCATGGCC
TTCGCCTTTATGTGGATCCCTGCTATTTCTCCCAAAAACTTCATACGTTGGCTCCTAGCT
GGGCAGCTGTTAACATTGTCCCGAGGTATTTCTCAAGTGCTTCCACTCTCACTGAACGGT
TTTCCCAGGTGTCAGTGGTTTTTGATCCTTATACGTCTGTCATTCACCCTCTTTGGTACT
ATTCAGTAATTATGTCCTGGAGGGTCTGCAGTCACCTGATAATGGCTATTTTTTCCCATG
GTTTTCTCAGTATGGTGATATACACAGTTTCAACTTCTGAGTTATTTTTCTTTGATTCCA
ATGTCCTCCTTGTCTTGTCCTACCCTGACCCACAGATACTGTCCATAGCTTCTTTGGACA
CTTGCCCTCAAGGAAATCAGCTATTTATTTTTGGAACAATAAGTTTTGCCAGCTCTCTCC
TGATGGTCCTCGTCTCCTATGTTTGCATCATGGCTGTCTTCTTCAAGATCCTGCCCTCCA
AAATGAGGCTCAAAGCCTTCTCTAGCTGTTTTTCTCACCTCTCAGGTGCCTCTTTGTTCT
ATGAGACTTCCTTCTTTGAGTGGGTAATATAGTCCAGTTAAATTTCTCTTCTGAATTATG
ACCAAATTAAATGAATGTTGATTGAATGTTGAATGTCTTGAAGCTCAAATTGGGTGTCTC
TAAGTAATGGATTCTTAACTTGGGGTACATGCAACATTTTttttaaaaac


Conceptual translation

FI*AEESVTLAPIYS\SIYSLCFN*FSLIFHLLLEIFT*LLHTYIEHDFTKITLESLIL
GCVSLEGMDLSVYFSI/HRLRACYKLLSLLLPEYEVMLASSCPGNHIPETVSLPSLASI
LVISITIVLVSYFYICSTEGSHKGFSTFTDYIMVVTRFL/CLLFYGHSFSYSFRPS*SF
T/DESVSIFYILAITILNLVIYNVKNKDELEALNRVLNK