Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR10A3 Olfactory Receptor

Gene Symbol OR10A3
Organism Cow
Family 10
Subfamily A
Pseudo No
Location chr15:45,214,200-45,215,100 (+)

Sequence information


Nucleotide sequence

ATGAAAAGGCAAAATCAAAGCTCTGTGGTTGAATTCATCCTCTTGGGCTTTTCTAATTTC
CCTGAACTCCAAAGGCAGCTCTTCCAGGTTTTCTTGGTTATTTACCTGGTGACTCTGATT
GGAAATGCCATCATTATAGTTGTCATCTCATTGGAACAGAGCCTCCATGTTCCCCTGTAT
CTATTTCTCCTGAACCTGTCTGTGGTGGAAGTAGGTTTCAGTGCAGTCATCATGCCTGAG
ATGCTGGTGGTCCTCTCCAGTGAAAAAACTGTGATCACTTTTGCAGGCTGTTTTTCACAG
ATGTATTTTATTCTTCTTTTTGGTGGGACTGAATGTTTTCTTCTGGGAGCAATGGCTTAT
GACCGATTTGCTGCCATCTGCCATCCTCTGAGCTACCCAGTGACTATGAACAAAAGGGTT
TTCATGAAATTGATTACATTCTCATGGGTCTCAGGGATCATAGTGGCTACTGTGCAGACC
ACATGGGTGTTTAGTTTTCCCTTTTGTGGCCCCAATGAAATTAATCATCTTTCATGTGAG
ACTCCCCCAGTGTTAGAGCTTGCATGTGCAGACACCTTTTTATTTGAGATCTACGCATTC
ACTGGCACCATTTTGATTGTTATGGTTCCTTTCCTGTTGATACTCTTATCTTACGTTCGA
ATTCTCTTTTCCATCTTAAAGATGCCATCAACCACTGGGAGGCAAAAGGCCTTTTCCACC
TGTGCCTCCCATCTCACATCTGTTACCCTCTTCTATGGCACAGCCAATATGACTTACTTA
CAACCTAAATCTGGCTACTCCCCAGAAACCAAGAAGCTGATGTCCTTGGCTTACTCTCTT
CTTACACCTCTGCTGAATCCACTGATATATAGCTTGCGCAACAGTGAGATGAAAAGAGCT
TTGATGAAATTATGGCAAAGAAAAGTGGATTTACATACAtttttaaat


Conceptual translation

MKRQNQSSVVEFILLGFSNFPELQRQLFQVFLVIYLVTLIGNAIIIVVISLEQSLHVPLY
LFLLNLSVVEVGFSAVIMPEMLVVLSSEKTVITFAGCFSQMYFILLFGGTECFLLGAMAY
DRFAAICHPLSYPVTMNKRVFMKLITFSWVSGIIVATVQTTWVFSFPFCGPNEINHLSCE
TPPVLELACADTFLFEIYAFTGTILIVMVPFLLILLSYVRILFSILKMPSTTGRQKAFST
CASHLTSVTLFYGTANMTYLQPKSGYSPETKKLMSLAYSLLTPLLNPLIYSLRNSEMKRA
LMKLWQRKVDLHTFLN