Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR10A3G Olfactory Receptor

Gene Symbol OR10A3G
Organism Cow
Family 10
Subfamily A
Pseudo No
Location chr15:***************** (+)
Aliases OR10A6, ENSBTAG00000040252

Sequence information


Nucleotide sequence

ATGAAAAGACAAAACCAAAGCTGTGTGGTTGAATTCATCCTCCTGGGCTTTTCTAACTTC
CCTGAACTCCAAGAGCAGCTCTTTGTGGTTTTCTTGGTGGTTTACCTGGTGACTCTGATG
GGAAATGTAATCATTATAGTCGTCATCTCCCTGGAACAGAGCCTGCATGTCCCCTTGTAC
CTGTTCCTCCAGAACTTGTCTGTGGTGGATATGGGTATCAGTGTGGTCATTATGCCTGTT
ATGCTGGTGATCCTTTCCACTGAGAAGATGAGGATTTTTACAGCGGGCTGTTTTGCACAA
ATGTACTTCATTCTTCTTTTTGGTGTGACTGAATGTTTTCTTCTGGGGGCAATGGCTTTT
GACCGATTTACTGCAATCTGCCATCCTCTGAGCTACCCAATGATTATGAACAAAATGGTT
TTCATGAAATTAGTTACATTCTCATGGGTCTCAGGGATCACAGTGGCTACTATGCAGACC
ACATGGGTGTTTAGTTTTCCCTTTTGTGGCTCCAATGAAATTAATCATCTCTTCTGTGAG
ACTCCCCCAGTGTTAGAGCTTGCATGTGCAGACACCTTTTTGTTTGAGATCTATGCATTC
ACTGGCACCATTCTGACAGTTATTGTTCCATTCTCGTTGATACTCTTGTCTTATGTTCGA
ATTCTCTTTGCCATCCTGAAGATGCCATCAACCACTGGGAGGCAAAAGTCCTTTTCTACC
TGTGCCTCCCATCTCACATCTGTTACCCTCTTCTATGGCACAGCAAATATGACTTACTTA
CAACCTAAATCTGGCTACTCCCCAGAAACCAAGAAGCTGATGTCCTTGGCTTACACGTTG
CTCGCACCTCTGCTGAATCCACTGATCTACAGCTTGCGAAACAGTGAGATGAAAAGAGCT
TTGATGAAATTATGGAGAAGAAAAGTGGATTTACATACATTC


Conceptual translation

MKRQNQSCVVEFILLGFSNFPELQEQLFVVFLVVYLVTLMGNVIIIVVISLEQSLHVPLY
LFLQNLSVVDMGISVVIMPVMLVILSTEKMRIFTAGCFAQMYFILLFGVTECFLLGAMAF
DRFTAICHPLSYPMIMNKMVFMKLVTFSWVSGITVATMQTTWVFSFPFCGSNEINHLFCE
TPPVLELACADTFLFEIYAFTGTILTVIVPFSLILLSYVRILFAILKMPSTTGRQKSFST
CASHLTSVTLFYGTANMTYLQPKSGYSPETKKLMSLAYTLLAPLLNPLIYSLRNSEMKRA
LMKLWRRKVDLHTF