Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR10A5 Olfactory Receptor

Gene Symbol OR10A5
Organism Cow
Family 10
Subfamily A
Pseudo No
Location chr15:46,478,100-46,479,100 (-)

Sequence information


Nucleotide sequence

ATGGCTGAAGGAAACTGGACAAGAGTTAATGAGTTTATCCTCATGAGTTTCTCTTCCTTA
CCTACTGAAATACAATCACTGCTCTTCCTGACATTTCTAGTCATCTACCTGGTCACTCTG
CTGGGAAACAGCCTCATCATTCTGGTTACCTTGGCTGACCCCATGCTGCACAGCCCCATG
TACTTCTTCCTCAGGAACTTGTCCTTCTTAGAGATTGGCTTCAACCTAGTCATTGTGCCC
AAGATGCTGGGGACCCTGATTGCCCAGGACACAACCATCTCCTTTCTTGGCTGTGCCACT
CAGATGTATTTCTTCTTCTTCTTTGGGGTTTCTGAATGCTCCCTCCTGGCCACCATGGCC
TATGACCGCTATGTAGCCATCTGCAGTCCCTTGCACTACCCAGTCATCATGAGCCCAAGG
GCACGTGCCAAACTGGCAGTTATCTCTTGGTTTCCAGGCATTCCTGTAGCTACTGTGCAG
ACCACATGGCTCTTCAGCTTTCCATTCTGTGGTAGCAACAAGGTGAACCACTTCTTCTGT
GACAGCCCACCTGTGCTGAGGCTGGTCTGTGCAGACACAGCACTGTTTGAGATCTATGCC
ATTATTGGAACCATTCTATTTGTCATGATTCCCTGCTTGCTGATCCTATGTTCCTACACT
TGCATTGCTGCTGCCATCCTGAAGATTCCATCGGCAAAGGGGAAGCATAAAGCCTTCTCT
ACCTGCTCCTCTCACCTGCTCGTCGTCTCCCTTTTCTATGTATCTTTAAGCCTTATCTAC
TTCCGTCCAAAGTCCAATAATTCTCCTGAAAGCAAGAAAGTGCTATCACTGTCCTACACT
GTTGTGACTCCCATGTTGAATCCCATCATCTACAGCCTGAGAAATAATGAGGTGAAGAAT
GCCCTTAGCCGGACCTTCCACAAGGCCCTAGGCCTTAGAAACTGCATCCCA


Conceptual translation

MAEGNWTRVNEFILMSFSSLPTEIQSLLFLTFLVIYLVTLLGNSLIILVTLADPMLHSPM
YFFLRNLSFLEIGFNLVIVPKMLGTLIAQDTTISFLGCATQMYFFFFFGVSECSLLATMA
YDRYVAICSPLHYPVIMSPRARAKLAVISWFPGIPVATVQTTWLFSFPFCGSNKVNHFFC
DSPPVLRLVCADTALFEIYAIIGTILFVMIPCLLILCSYTCIAAAILKIPSAKGKHKAFS
TCSSHLLVVSLFYVSLSLIYFRPKSNNSPESKKVLSLSYTVVTPMLNPIIYSLRNNEVKN
ALSRTFHKALGLRNCIP