Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR10A5H Olfactory Receptor

Gene Symbol OR10A5H
Organism Cow
Family 10
Subfamily A
Pseudo No
Location chr15:46,516,500-46,517,400 (+)

Sequence information


Nucleotide sequence

ATGGTTGAAGGAAACTGGACAAAAGTTAATGAGTTTAGCCTCATGAGTTTCTCTTCCTTA
CCTACTGAAATACAGTCATTAATTTTCCTGACATTTCTATTCATCTACCTGGTCACTCTT
CTGGGAAACAGCCTCATCATTCTGGTTACCTTGGCTGACCCCATGCTGCACAGCCCCATG
TACTTCTTCCTCAGGAACTTGTCCTTCTTAGAGATTGGCTTCAACCTAGTCATTGTGCCC
AAGATGCTGGGGACCCTGATTGCCCAGGACACAACCATCTCCTTTCTTGGCTGTGCCACT
CAGATGTATTTCTTCTTCTTCTTTGGGGTTTCTGAATGCTTCCTCCTGGCCACCATGGCC
TATGACCGCTATGTAGCCATCTGCAGTCCCTTGCACTACCCAGTCATCATGAACCCAAGG
ACACGTGCCAAACTGGCAGCTGTCTCCTGGTTTCCAGGCATTCCCATGGCTACTGTGCAG
ACCACGTGGCTCTTCAGCTTTCCATTCTGTGGCATCAACAAGGTGAACCACTTCTTCTGT
GACAGCCCTCCTGTGCTGAGGCTGATCTGTGCAGACACAGCGCTATTTGAGATCTATGCC
ATCATTGGAACCATTCTGGTTGTCATGATTCCCTGCTTGCTGATCCTATGTTCCTACACT
CGCATCGCTGCTGCCATCCTGAAGATTCCATCGGCTAAGGGGAAGCATAAAGCCTTCTCT
ACCTGCTCATCCCACCTACTTGTTGTTTCCCTCTTCTATGTATCTTTAAGCCTCACCTAC
TTTCGGCCTAAGTCCAATAATTCTCCTGAGAGCAAAAAAGTGCTATCACTGTGCTACACG
GTTGTAACTCCCATGTTGAACCCCATCATCTACAGCTTGAGAAATAGTGAGGTGAAGAAT
GCCCTTGGTCGGACCTTCCATAAGGCTATGGGTGTCAGAACTGCATTCTGTAGGCATTTT
GAGGTA


Conceptual translation

MVEGNWTKVNEFSLMSFSSLPTEIQSLIFLTFLFIYLVTLLGNSLIILVTLADPMLHSPM
YFFLRNLSFLEIGFNLVIVPKMLGTLIAQDTTISFLGCATQMYFFFFFGVSECFLLATMA
YDRYVAICSPLHYPVIMNPRTRAKLAAVSWFPGIPMATVQTTWLFSFPFCGINKVNHFFC
DSPPVLRLICADTALFEIYAIIGTILVVMIPCLLILCSYTRIAAAILKIPSAKGKHKAFS
TCSSHLLVVSLFYVSLSLTYFRPKSNNSPESKKVLSLCYTVVTPMLNPIIYSLRNSEVKN
ALGRTFHKAMGVRTAFCRHFEV