Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR10A7 Olfactory Receptor

Gene Symbol OR10A7
Organism Cow
Family 10
Subfamily A
Pseudo No
Location chr5:59,656,400-59,657,400 (-)

Sequence information


Nucleotide sequence

ATGATCTGTGAAAATCACACCCAAGTGACTGAATTTATCCTTCATGGTTTTACAAACAAG
CCTGAGATGCAACATTCCCTATTTGTTTTGTTCCTGGTCATCTATACAGTCACTTTGTTG
GGTAACTTCCTTATTGTCACAGTTACCATTGTGGATCCTGCTCTTCAAACACCCATGTAC
TTCTTTCTCAGGAACTTGTCACTTCTTGAAATCTGTTTCACCTTGGTCATGGTGCCAAAG
ATGTTGGTAGATCTAGTATCCCCAAGGAAAAGCATCTCTTTTGTAGGCTGTGGTACCCAG
ATGTACTTCTTTTTCTTCTTTGGCAGCTCTGAATGTTTCCTCCTCTCTATGATGGCTTAT
GATCGCTTTGTAGCCATCTGTAATCCTCTCCGCTATTCAGTCATAATGAATAGGTCCCTA
TGTTTGTGGATGGCTGTAGGTTCTTGGCTGTCTGGTGTTCCCGTGTCTATGCTACAGACA
GCTTGGTTGATGGCCCATCCTTTCTGTGGACCAAGCACCATAGACCACTTCTTTTGTGAT
GGTCCCCCAGTGTTGAAACTAGTCACTGAGGATACAACCATATATGAAATGCAAGCACTT
GCCTCCACACTACTATTTATTATGTTTCCCTTTTCCCTCATTTTGGTCTCCTACACTCGC
ATTATTAAAACCATCCTGATGATGCCCTCTGCTACCGGTCGCCAGAAGGCATTCTCCACT
TGTTCATCTCACCTCATTGTGGTATCCCTTTTCTATGGAACAGCCAGCTTGACCTACCTA
CGGCCCAAATCCAAACAGTCTCCCGAGAGCAAGAAGCTAGTATCATTGTCCTACACTGTC
ATCACACCGATGTTAAACCCCATCATCTACAGCCTAAGGAACAATGAAGTGAAGGGGGCA
GTCAAGAGGACATTCACTCGAAAAGTCTTGCAGAAGTTAGGTGTGCTT


Conceptual translation

MICENHTQVTEFILHGFTNKPEMQHSLFVLFLVIYTVTLLGNFLIVTVTIVDPALQTPMY
FFLRNLSLLEICFTLVMVPKMLVDLVSPRKSISFVGCGTQMYFFFFFGSSECFLLSMMAY
DRFVAICNPLRYSVIMNRSLCLWMAVGSWLSGVPVSMLQTAWLMAHPFCGPSTIDHFFCD
GPPVLKLVTEDTTIYEMQALASTLLFIMFPFSLILVSYTRIIKTILMMPSATGRQKAFST
CSSHLIVVSLFYGTASLTYLRPKSKQSPESKKLVSLSYTVITPMLNPIIYSLRNNEVKGA
VKRTFTRKVLQKLGVL