Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR10AA1C Olfactory Receptor

Gene Symbol OR10AA1C
Organism Cow
Family 10
Subfamily AA
Pseudo No
Location chr3:10,991,100-10,992,100 (+)

Sequence information


Nucleotide sequence

ATGGACCTTGTCAATCACACGTGGACCCAGAGTTTTCTCCTTGCTGGTTTCACTACCACT
GGAGCCCTGCAACCTCTTGCTTTCTTGGGGACACTGTGCATCTATCTCCTCACCCTGGCA
GGGAACTTGTTCATCATTGTGCTGGTTCAGGCAGATTCGAGACTGTCCACACCCATGTAC
TTCTTCATCAGTGCCCTCTCCTTCTTGGAACTCTGGTATGTCAGCACCACAGTGCCCACA
CTGCTGCACACCTTGCTCCATGGGCGTTCACCCATCTCACCAACTGTGTGCTTTGTCCAG
CTCTATGTCTTCCATTCACTGGGCATGACTGAGTGCTACCTGTTGAGTGTCATGGCACTG
GACCGCTACCTTGCCATCTGTCGCCCACTGCACTACCATGCTCTTATGAGCAGACAGGTA
CAGTTATGGCTAGCAGGGGCCACCTGGGCAGCTGGCTTCTCAGCTGCACTTGTGCCAGCA
AGGCTCACAGCCACTCTGCCCTTCTGCTTAAAAGAGGTGGCTCATTACTTCTGTGACCTG
GCACCACTAATGAGGCTGGCGTGCGTGGACACAGGTTGGCATGCTCAAGTCCACATTGCA
GTGATTGGCATTATCAATGCTTGCAATCTTGTGCTCATTTTAGGACTGTATGGGGGCATC
CTGAGAGCTGTGCTGAAGCTGCCCTCAGCTGCCAGCCGTGCAAAAGCCTTTTCCACCTGT
TCCTCCCACATAACTGTAGTGGTGCTATTCTTTGCCTCTGCTTTCATTGTCTATGTGGGG
CCACCTGAGAGTCTCCCTGAAGGCACTGACAAACTTCTTGCTTTGGTGTATACTTTTCTG
ACCCCTTTTCTCAACCCCATTATTTACACTTTTCGTAACAAAGAAGTGAGAGAGGCTGTC
AGGAGAGTCACCCAAAGCATTAGGGCTATGATGAAGAGACCC


Conceptual translation

MDLVNHTWTQSFLLAGFTTTGALQPLAFLGTLCIYLLTLAGNLFIIVLVQADSRLSTPMY
FFISALSFLELWYVSTTVPTLLHTLLHGRSPISPTVCFVQLYVFHSLGMTECYLLSVMAL
DRYLAICRPLHYHALMSRQVQLWLAGATWAAGFSAALVPARLTATLPFCLKEVAHYFCDL
APLMRLACVDTGWHAQVHIAVIGIINACNLVLILGLYGGILRAVLKLPSAASRAKAFSTC
SSHITVVVLFFASAFIVYVGPPESLPEGTDKLLALVYTFLTPFLNPIIYTFRNKEVREAV
RRVTQSIRAMMKRP