Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR10AB2 Olfactory Receptor

Gene Symbol OR10AB2
Organism Cow
Family 10
Subfamily AB
Pseudo No
Location chr15:45,542,500-45,543,400 (+)

Sequence information


Nucleotide sequence

ATGGGCAATCATACCACAGTGAGCACCTTCCTTCTGTGGGGATTTTCCAGTTTCTCAGAC
CTGCAGGATCTCCTCTTTGTGATGGTTTTCTTCTCCCATGTGACCATCCTAGCCGCAAAC
ACATCCGTAATGCTGGCCGTCAAGCTCAGTCACAACCTTCACACTCCCATGTACTTTTTC
CTCTGTGGCCTCTCCTTTTCAGAAACCTGTACCACTGTGGTAGTCATCCCTCGCATGTTG
GTGGACTTGCTATCAGACAGTAAGTCCATTTCTATTCCTGAGTGTGCCACACAGATGTTT
TTCTTCTTTGGCTTAGGAACCAACAACTGCTTCATCTTGGCCGCCATGTCCTATGACCGT
TACACTGCTATTCACAACCCACTGCACTACTCCATCCTCATGACCCGGAAGATCTGCTTT
CAGCTGATGATGGCTTCTTGCATCACTGGGGTTGTGGTGTCACTGTGCATCATCCTCATA
GTATTCAACTTGTCTTTCTGTGACTCCAGCATCATCCAGCATTTTTTTTGTGACATTACA
CCTGTAGTCTCCCTTGCCTGTGATTACACCATTTTTCAGAAAATGATTCTTCTTGCCTTC
ACTGCCTTTGTGTTGGTGGGCAGCTTTATTTTAATTATGATTTCCTATGTCTTCATTGGG
TCCATAGTTATGAAGATGCCTTCAGCCAAGGGAAGGTATAAGGCCTTCTCAACTTGTTCC
TCCCACCTCACTGTGGTGTGCACACACTATGGATTTGCTGGCTTTGTCTATTTGAGGCCC
AAGAGCCGTGACTCATTCCGTGAAGATATGCTGATGGCTGTGACATATACAGTGCTGACA
CCTCTGCTTAATCCCATTGTTTACAGTCTAAGAAACAAAGAAATGCAAACAGCCCTAAAG
AAAGCACTAGGCAATATATGTAGGTTTTCCCCT


Conceptual translation

MGNHTTVSTFLLWGFSSFSDLQDLLFVMVFFSHVTILAANTSVMLAVKLSHNLHTPMYFF
LCGLSFSETCTTVVVIPRMLVDLLSDSKSISIPECATQMFFFFGLGTNNCFILAAMSYDR
YTAIHNPLHYSILMTRKICFQLMMASCITGVVVSLCIILIVFNLSFCDSSIIQHFFCDIT
PVVSLACDYTIFQKMILLAFTAFVLVGSFILIMISYVFIGSIVMKMPSAKGRYKAFSTCS
SHLTVVCTHYGFAGFVYLRPKSRDSFREDMLMAVTYTVLTPLLNPIVYSLRNKEMQTALK
KALGNICRFSP