Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR10AD1CP Olfactory Receptor

Gene Symbol OR10AD1CP
Organism Cow
Family 10
Subfamily AD
Pseudo Yes
Location chr5:32,240,300-32,241,300 (+)

Sequence information


Nucleotide sequence

AGGCCCCAGGTGGTAGACACAAGGAATGGCAGCACCGTGACTGAGTTTATCCTCGTGGGC
TTTGAGCAGAGCTCCCCATCCACTCGGACATTGCTCTTTGCCCTCTTCCTAACCCTCTAC
AGCCTTGCCATGGCCATGAATGGCCTCATCATCTTCATCACCTGGACAGACCCCAGGCTC
AACAGCCCCATGTACTTCTTCCTTGGCCACCTGTCCTTACTGGATGTCTGCTTCATCACC
ACCACCATCCCACAGATGCTGATCCACCTAGTGATAAAGAATCACACTCTCACCTTTGCC
TCCTGCTTAACCCAGATGTATCTGGTTTTTGGTGTGGGTGTGGCTGAGTGCATCCTCTTG
GCTTTCATGGCCTATGACCGTTATGTTGCCATCTGCCACCCACTTAGCTATGCCCAGATC
ATGAGCCGGCAGGTCTGTGTGAGACTGGTGAGTACAGCCTGGTTCTTTGGGCTGATCAAT
GGCATCCTTCTTGACTACATGACATTTCGTGGTCCCTTCTGCAGAGACAACCACATAGAA
AACTTCTTCTGTGAGGCCCCCATAGTGATTGCTCTCTCCTGTGGAGACCCCCAGTTTAGT
CTGAGAGTCATCTTTGCCGATGCCATTGTGGTGCTGCTCAGCCCCGTGGTGCTCATCGTC
ATCTCCTATGCCCGCATCCTGGCCTCCATCCTGGGCAGGAACTCCTCCTCTGGTCGAGGC
AAGACCTTCTCTACTTGTGCCTCTCATCTGACCGTGGTCATCTTTTTCTACACCTCGGCC
ATGTTCTCTTACATGAACCCCCGCAGCACACACGGTCCTGACAAAGACAAGCCTTTCTCC
CTCCTCTACACCATCATCACCCCCATGTGCAACCCCGTCATCTACAGTTTCCGAAACAAA
GAAATGAAGGGGGCCATGGCGAGGGCCCTTGGGAGAAGCAGCCTTTCCCAAGCAGAGTCT


Conceptual translation

RPQVVDTRNGSTVTEFILVGFEQSSPSTRTLLFALFLTLYSLAMAMNGLIIFITWTDPRL
NSPMYFFLGHLSLLDVCFITTTIPQMLIHLVIKNHTLTFASCLTQMYLVFGVGVAECILL
AFMAYDRYVAICHPLSYAQIMSRQVCVRLVSTAWFFGLINGILLDYMTFRGPFCRDNHIE
NFFCEAPIVIALSCGDPQFSLRVIFADAIVVLLSPVVLIVISYARILASILGRNSSSGRG
KTFSTCASHLTVVIFFYTSAMFSYMNPRSTHGPDKDKPFSLLYTIITPMCNPVIYSFRNK
EMKGAMARALGRSSLSQAES