Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR10AD1DP Olfactory Receptor

Gene Symbol OR10AD1DP
Organism Cow
Family 10
Subfamily AD
Pseudo Yes
Location chr5:32,213,900-32,214,900 (+)

Sequence information


Nucleotide sequence

AGCAGATCCACACCAGCGGACCTAAGGAATGGCAGCACCGTGACTGAGTTTATCCTCGTG
GGCTTTGAGCAGAGCACCCCTTCCACTCGGGCATTGCTCTTTGCCCTCTTCCTAGCCCTC
TACAGCCTTGCCATGGCCATGAATGGCCTCATCATCTTCATCACCTGGACAGACCCCAGG
CTCAACAGCCCCATGTACTTCTTCCTTGGCCACCTGTCCTTCCTGGATGTCTGCTTCATC
ACCACCACCATCCCACAGATGCTGGTCCACCTGACAGTGAAGAACCATGTTGTCTCCTTT
GTCTCTTGCATGACCCAGATGTACTTGGTCTTCTGTGTGGGTGTGGCTGAGTGCATCCTC
TTGGCTTTCATGGCCTATGACCGTTATGTTGCCATCTGCCACCCACTTAGCTATGCCTAG
ATCATGAGCCAGCAGGTCTGCGTGAGCCTGGTGAGTATTGCCTGGTCCTTTGGGCTAATC
AATGGCATCTTGCTTGAGTATATGTCATTCTGGAATCCCTTCTGCAGAGACAACCACATA
GAAAACTTCTTCTGTGAGGCCCCCATAGTGATTGCTCTCTCCTGTGGAGACCCCCAGTTT
AGTCTGAGAGTCATCTTTGCCGATGCCATTGTGGTGCTGCTCAGCCCCATGGTGCTCATC
GTCATCTCCTATGCCCGCATCCTGGCCTCCATCCTGGGCAGGAACTCCTCCTCTGGTCGA
GGCAAGACCTTCTCTACTTGTGCCTCCCATCTGACCGTGGTCATCTTTTTCTACACCTCG
GCCATGTTCTCTTACATGAACCCCCGCAGCACACACGGTCCTGACAAAGACAAGCCTTTC
TCCCTCCTCTACACCATCATCACCCCCATGTGCAACCCTGTCATCTACAGTTTCTGAAAC
AAAGAAATGAAGGGGGCCATGGCGAGGGCCCTTGGGAGAAGCAGCCTTTCCCAGGCAGAG
TCTGTC


Conceptual translation

SRSTPADLRNGSTVTEFILVGFEQSTPSTRALLFALFLALYSLAMAMNGLIIFITWTDPR
LNSPMYFFLGHLSFLDVCFITTTIPQMLVHLTVKNHVVSFVSCMTQMYLVFCVGVAECIL
LAFMAYDRYVAICHPLSYA*IMSQQVCVSLVSIAWSFGLINGILLEYMSFWNPFCRDNHI
ENFFCEAPIVIALSCGDPQFSLRVIFADAIVVLLSPMVLIVISYARILASILGRNSSSGR
GKTFSTCASHLTVVIFFYTSAMFSYMNPRSTHGPDKDKPFSLLYTIITPMCNPVIYSF*N
KEMKGAMARALGRSSLSQAESV