Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR10AD1P Olfactory Receptor

Gene Symbol OR10AD1P
Organism Cow
Family 10
Subfamily AD
Pseudo Yes
Location chr5:32,263,600-32,264,600 (+)

Sequence information


Nucleotide sequence

GCGGACCTAAGGAATGGCAGCACCGTGACTGAGTTTATCCTCGTGGGCTTTGAGCAGAGC
TCCCCATCCACTCGGGCATTGCTCTTTGCCCTCTTCCTAGCCCTCTACAGCCTTGCCATG
ACCATGAATGGCCTCATCATCTTCATCACCTGGACAGACCCCAGGCTCAACAGCCCCATG
TACTTCTTCCTTGGCCACCTGTCCTTCCTGGATGTCTGCTTCATCACCACCACCATCCCA
CAGATGCTGGTCCACCTGACAGTGAAGAACCATGTTGTCTCCTTTGTCTCTTGCATGACC
CAGATGTACTTGGTCTTCTGTGTGGGTGTGGCTGAGTGCATCCTCTTGGCTTTCATGGCC
TATGACCGTTATGTTGCCATCTGCCACCCACTTAGCTATGCCCAGATCATAAGCCAGCAG
GTCTGCGTGAGCCTGGTGAGTATTGCCTGGTCCTTTGGGCTAATCAATGGCATCTTGCTT
GAGTATATGTCATTCTGGAATCCCTTCTGCAGAGACAACCACATAGAAAACTTCTTCTGT
GAGGCCCCCATAGTGATTGCTCTCTCCTGTGGAGACCCCCAGTTTAGTCTGAGAGTCATC
TTTGCCGATGCCATTGTGGTGCTGCTCAGCCCCATGGTGCTCATCGTCATCTCCTATGCC
CGCATCCTGGCCTCCATCCTGGGCAGGAACTCCTCCTCTGGTCGAGGCAAGACCTTCTCT
ACTTGTGCCTCCCATCTGACCGTGGTCATCTTTTTCTACACCTCGGCCATGTTCTCTTAC
ATGAACCCCCGCAGCACACACGGTCCTGACAAAGACAAGCCTTTCTCCCTCCTCTACACC
ATCATCACCCCCATGTGCAACCCCGTCATCTACAGTTTCCGAAACAAAGAAATGAAGGGG
GCCATGGCGAGGGCCCTTGGGAGAAGCAGCCTTTCCCAGGCAGAGTCTGTC


Conceptual translation

ADLRNGSTVTEFILVGFEQSSPSTRALLFALFLALYSLAMTMNGLIIFITWTDPRLNSPM
YFFLGHLSFLDVCFITTTIPQMLVHLTVKNHVVSFVSCMTQMYLVFCVGVAECILLAFMA
YDRYVAICHPLSYAQIISQQVCVSLVSIAWSFGLINGILLEYMSFWNPFCRDNHIENFFC
EAPIVIALSCGDPQFSLRVIFADAIVVLLSPMVLIVISYARILASILGRNSSSGRGKTFS
TCASHLTVVIFFYTSAMFSYMNPRSTHGPDKDKPFSLLYTIITPMCNPVIYSFRNKEMKG
AMARALGRSSLSQAESV