Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR10AG1 Olfactory Receptor

Gene Symbol OR10AG1
Organism Dog
Family 10
Subfamily AG
Pseudo No
Location chr18:39894988-39895935 (+)
Aliases cOR10AG2, cOR10AG2

Sequence information


Nucleotide sequence

ATGGAGAACACATTAAAAACAGAAAATTTTAATGTTACTACCATTGTGGAATTTGTTCTC
TTGGGGTTTTCTGATATTCCCAATCTCCAATGGATTCTTTTTGGGATATTTTTAGTCATC
TACCTAACTATACTGATGTGTAATAGCATCATAATATTGATAATAAGAATTGACCCTGCT
CTCCAGACCCCCATGTATTTTTTTCTTAGCAATTTTTCCTTCTTAGAAATCTGTTATGTA
ACAGTCACTATCCCAAGAATGCTCATGGACCTATTGACCCAGAAAGGAAATATTTCTTTC
TTTGCCTGTGCTGCACAAATGTGTTTTGTCCTTATGTTTGGAGGCTCAGAATGTCTTCTC
CTGACAGTGATGGCCTATGATCGCTACGTGGCCATTTGTAACCCTCTGCATTACCCTCTC
GTCATGAACCACAAGGTCTGTGTCCAGCTGGTGACTGTTGCCTGGATCAGTGGAGTACCA
GTTGTGATTGGACAAACATGCCAGATTTTCTCTCTGCCCTTCTGTGGGTCTAACACAATT
AATCATTTCTTCTGTGACCTTCCCCCAGTACTCAAGCTTGCTTGTGGGGACACATTTTTG
AACGAGATAGCAGTCTATGTTGTTGCAGTGGTCTTCGTCATGATTCCTTTTCTGTTGATT
GTTGTTTCCTATGGCAAAATCATCTCCAACATTCTGAAATTGTCAACAGCCAAAGGAAGG
GCTAAAGCCTTCTCCACCTGTTCTTCTCACCTGATAGTTGTAGTCTTATTCTATGGAACA
GCTACTATCACTTATTTACAACCCAAACCAAATCAATCTGAAGGAGTTGGGAAATTGATT
TCTCTTTTCTATACCATTTTGATCCCAACATTGAATCCCCTTATATATACTCTGAGGAAC
AAAGATATCATGGTAGCACTGAGAAAACTACTAACGAAGTTATTACCG


Conceptual translation

MENTLKTENFNVTTIVEFVLLGFSDIPNLQWILFGIFLVIYLTILMCNSIIILIIRIDPA
LQTPMYFFLSNFSFLEICYVTVTIPRMLMDLLTQKGNISFFACAAQMCFVLMFGGSECLL
LTVMAYDRYVAICNPLHYPLVMNHKVCVQLVTVAWISGVPVVIGQTCQIFSLPFCGSNTI
NHFFCDLPPVLKLACGDTFLNEIAVYVVAVVFVMIPFLLIVVSYGKIISNILKLSTAKGR
AKAFSTCSSHLIVVVLFYGTATITYLQPKPNQSEGVGKLISLFYTILIPTLNPLIYTLRN
KDIMVALRKLLTKLLP