Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Horse symbols

Horse OR10AG112P Olfactory Receptor

Gene Symbol OR10AG112P
Organism Horse
Family 10
Subfamily AG
Pseudo Yes
Location chrUn:9879491-9880006 (+)

Sequence information


Nucleotide sequence

GAAAAAAAAAATGCAGGTGGAAATCTCACTTCAGTGATGGAATTTGTTCGTTTGGGATTT
TCTGTTATTCTCAATCTCCACATTGTTCTTTTTGTGATATTTTTCTTTGTCTATGTGACA
ATTCTGATGGGAAACAGCATCATTATTCTCATAAGCAGGATTGACCACACTCTACAGAGC
CCCACGTATTTTTTCCTCAGTAATTTTTCCTTCTTGGAAATTTGTTGTGTATCTGTCACT
CTTCCTAGAATGCTCATACCCCTTTGGACACAGAAAAGAAACATTTCTTTGTTTGTCTGT
ACAACACAAATGAGTTTTGCCCTTATGCTTGGAAACATAGAGTGCCTCCTTCTTACAGTG
ATGGTCTATTACTGTTATATAGCCATTTGCAACCCTCTGCGCCATCCTCTAGTCGTGAAC
CACAGGGTCTGTGTCCAGCTGGTGTCTGCCACCTGGATCACTAGAATTCCAGTTGGGATA
GGGAGACATGCCAGATTTTCTTTCTGTGTTTTGGTA


Conceptual translation

EKKNAGGNLTSVMEFVRLGFSVILNLHIVLFVIFFFVYVTILMGNSIIILISRIDHTLQS
PTYFFLSNFSFLEICCVSVTLPRMLIPLWTQKRNISLFVCTTQMSFALMLGNIECLLLTV
MVYYCYIAICNPLRHPLVVNHRVCVQLVSATWITRIPVGIGRHARFSFCVLVDVT\HIF
CDIPPIVKLAWRDSFLNEILRFTVAV