Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR10AG63 Olfactory Receptor

Gene Symbol OR10AG63
Organism Cow
Family 10
Subfamily AG
Pseudo No
Location chr15:79,934,100-79,935,000 (-)

Sequence information


Nucleotide sequence

ATGGGATCCAGAGGACAAAATCCCCCACAGTGGAACCAGACTACATTGGTGGATTTCATC
TTGCTTGGCTTCTCTGATATTCCCGACCTACAAGGATTTCTTTTTGGGGTGTTTTTGATC
ATGTATATGATTATTCTGATGGGAAATAGTCTCATTATCACAATAACCAAGATGGATCCT
TCCCTCCAGACTCCCATGTACTTTTTCCTAGGGAATTTTTCTTCCTTGGAAATATGTTAT
GTATCAGTCACTGTCCCAAGGTTATTAATAGATCTTTGCAGTCAAAGCAGAAATATATCC
TTTCTGGCCTGTGCTGCTCAAATGTATTTCTTTCTGGTGTTTGGAGCCACTGAGTGCCTT
CTTCTGACTTCAATGGCTTATGACAGGTATGTCGCCATTTGCAACCCACTGCTGTACCCT
CTCCTCATGAACAGTAGGTTGTGTATCCAACTGGCCGCTGGCTGTTGGGTCAGTGGAGTT
CCAGTGCATATAGTGTTAACCTACCAGATCTTCTCTCTACCCTTCTGTGGCTCTAACCAG
TTGAATCACTTCTTCTGTGACATACCTCCAGTGCTTAAGCTTGCCTGTGGGGACACCCTT
ATAACTGAGACATTAGTGTATGTAATTGCTGTTCTAGTTGTCACTGTTCCTTTTATGTTG
ATTCTTGGATCTTACGTGAGAATAATTGAGACCATCTTGAAGCTGCCTTCAGCCACTGGG
CGAGCCAAGGCCTTCTCCACCTGCTCCTCCCATCTCATGGTTGTGGCTTTATTCTTTGGA
TCAGGACTCATTACATATTTAAGACCAAAGTCCAGTCATTCTAAAGGAATGGACAAATTT
CTCTCTCTTTTTTATACCATTGTCACACCAATGTTTAACCCCATGATATATTGTCTGAGA
AATAAAGACGTTATGGTAGCACTGAGAAAATTTTTACTGAAA


Conceptual translation

MGSRGQNPPQWNQTTLVDFILLGFSDIPDLQGFLFGVFLIMYMIILMGNSLIITITKMDP
SLQTPMYFFLGNFSSLEICYVSVTVPRLLIDLCSQSRNISFLACAAQMYFFLVFGATECL
LLTSMAYDRYVAICNPLLYPLLMNSRLCIQLAAGCWVSGVPVHIVLTYQIFSLPFCGSNQ
LNHFFCDIPPVLKLACGDTLITETLVYVIAVLVVTVPFMLILGSYVRIIETILKLPSATG
RAKAFSTCSSHLMVVALFFGSGLITYLRPKSSHSKGMDKFLSLFYTIVTPMFNPMIYCLR
NKDVMVALRKFLLK