Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR10AG66 Olfactory Receptor

Gene Symbol OR10AG66
Organism Dog
Family 10
Subfamily AG
Pseudo No
Location chr18:39941615-39942661 (+)
Aliases cOR12E5, cOR12E5

Sequence information


Nucleotide sequence

ATGGGAAAAATTGGTAGGCATGCCATCCTGTTTGTGTGCAAGAAGACAAGAACCAAAGAA
ATCAGAGTAACTTGGACTTCTGATTCAATCATTCCCACAGATGACGTTGAAGAGATGAGA
GCAGAAGACAATGGTTCCACAATAACACAATTTGTACTCTTGGGATTTTCTGACCTTCCA
AACCTCCAAGGGTTTCTATTTGGGGTGTTCTCCATCGTTTATGTTATTATCTTAATTGGA
AATAGCCTCATAATAATAATAACCAGTCTTGATGCTGCACTCCAGAAACCCATGTATTTT
TTCCTGGCAAATTTTTCCTCCTTGGAAATCTGTTATGTGTCTGTCACCCTCCCCAGGATT
CTGGTGAACCTTTGGACTCAGGACAGAAGCATTTCTTGGTTGGGCTGTGCCACTCAAATG
TGCTTCTTCCTCATGCTGGGAGCCACTGAATGTTTCCTCTTGGCAGTGATGGCCTATGAC
CGCTACGTGGCCATTTGTAACCCTCTGCACTACCCTCTCATCGTGAACCACAAGATGTGC
GTCCAACTGGCTGTTGGTGCCTGGCTTAGTGGAATTCCAGTCCAGATAGGACAAACATGT
CAGGTGTTCTCGCTGCCTTTCTGTGGTTCTAACCAAATTAACCACTTCTTCTGTGACATC
CCCCCATTGATCAAGCTGGCTTGTGGGGACACTTCACTTAATGAGATGTGTGTCTTTGTA
GTTGCTATATTATTTGCAATGATTCCCTTTCTATTTATACTTGGCTCTTATGTGAAAATC
ATTTCCACCATCCTAAAGTTATCCTCAGCCAGGGGCCGGTCTAAAGCCTTCTCCACCTGT
TCTTCCCATATCATTGTTGTGCTTTTATTCTTTGGATCGGCTACCATCACCTACTTAAGG
CCCAAATCCATTCATTCTGCTGGAACTGACAAAATGTTGTCTCTTCTCTATACCATTGTG
ACTCCGATGTTTAATCCTATGATATACAGTCTTAGGAACAAGGATGTGATTGCAGCACTC
AGAAGACTGTTACTTAAAAAAATAGTG


Conceptual translation

MGKIGRHAILFVCKKTRTKEIRVTWTSDSIIPTDDVEEMRAEDNGSTITQFVLLGFSDLP
NLQGFLFGVFSIVYVIILIGNSLIIIITSLDAALQKPMYFFLANFSSLEICYVSVTLPRI
LVNLWTQDRSISWLGCATQMCFFLMLGATECFLLAVMAYDRYVAICNPLHYPLIVNHKMC
VQLAVGAWLSGIPVQIGQTCQVFSLPFCGSNQINHFFCDIPPLIKLACGDTSLNEMCVFV
VAILFAMIPFLFILGSYVKIISTILKLSSARGRSKAFSTCSSHIIVVLLFFGSATITYLR
PKSIHSAGTDKMLSLLYTIVTPMFNPMIYSLRNKDVIAALRRLLLKKIV