Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR10AG67 Olfactory Receptor

Gene Symbol OR10AG67
Organism Dog
Family 10
Subfamily AG
Pseudo No
Location chr18:39980198-39981130 (+)
Aliases cOR12E7, cOR12E7

Sequence information


Nucleotide sequence

ATGAGAGCAGAAGACAATGGTTCCAGAATAACACAATTTGTACTCTTGGGATTTTCTGAC
CTTCCAAACCTCCAAGGGTTACTATTTGGGGTGTTCTCCATCATTTATGTTATTATCTTA
ATTGGAAATAGCCTCATAATAATAATAACCAGTCTTGATGCTGCACTCCAGAAACCCATG
TATTTTTTCCTGGCAAATTTTTCCTACTTGGAAATCTGTTATGTGTCTGTCACCCTCCCC
AGGATTCTGGTGAACCTTTGGACTCAGGACAGAAGTATTTCTTGGTTGGGCTGTGCCACT
CAAATGTGCTTTTTCCTTATGCTGGGAGCCACTGAATGTTTCCTCCTGGCTGTGATGGCC
TATGACCGCTACGTGGCCATTTGTAACCCTCTGCACTACCCTCTCATCATGAACCACAAG
ATGTGCATCCAACTGGCTGTTGGGTCCTGGATTGGTGGAGTCCCAGGCCAAATAGGACAA
ACATGGCAGATTTTCTCTCTACATTTCTGTAATTCTAACCAAATCAACCACTTCTTCTGT
GACATACCTCCCATCCTCAAGCTAGCCTGTGGGGACACTGTTGTGCATGAGATAGCAGTC
TATGTACTAGCTGTGTTGTTTGTTGCAGTTCCTTTTCTGTTAATACTTGCCTCTTACAGC
AAAATCATTTCCACCATTCTGAGGTTGCCAACAGCCAGAGGACGGGCCAAGGCTTTCTCC
ACCTGTTCTTCCCATCTCATTGTTGTGCTTTTATTCTTTGGATCGGCTACCATCACCTAC
TTAAGGCCCAAATCCAATCATTCTGCAGGAACTGACAAGATGTTCTCTCTTTTCTATACC
ATTGTGACCCCGATGTTTAATCCTATGATATACAGCCTTAGGAACAAGGATGTGATTGCA
GCACTCAGAAGACTGTTACTTAAAAAAATAGTG


Conceptual translation

MRAEDNGSRITQFVLLGFSDLPNLQGLLFGVFSIIYVIILIGNSLIIIITSLDAALQKPM
YFFLANFSYLEICYVSVTLPRILVNLWTQDRSISWLGCATQMCFFLMLGATECFLLAVMA
YDRYVAICNPLHYPLIMNHKMCIQLAVGSWIGGVPGQIGQTWQIFSLHFCNSNQINHFFC
DIPPILKLACGDTVVHEIAVYVLAVLFVAVPFLLILASYSKIISTILRLPTARGRAKAFS
TCSSHLIVVLLFFGSATITYLRPKSNHSAGTDKMFSLFYTIVTPMFNPMIYSLRNKDVIA
ALRRLLLKKIV