Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR10AG68 Olfactory Receptor

Gene Symbol OR10AG68
Organism Dog
Family 10
Subfamily AG
Pseudo No
Location chr18:39924676-39925647 (-)
Aliases cOR10n, cOR10n, cOR12E8

Sequence information


Nucleotide sequence

ATGTTGAATTCTTTATTTTCACAGATGCTACCCAGAGACCAAACTACAGAAGGCAATTTG
TCTTCAGTTGTGGCATTTGTTCTCCTGGGATTTTCTGACCTTCCTAACATCCAGGGATTT
CTATTTGGAATTTTCTTTCTCATCTACATGTCCATCTTAATAGGAAATGGTCTTATCATA
ATAATTACAAGGGTAGACTCTGTTCTCCAGACACCCATGTATTTTTTCATTGCAAATTTT
TCCTCCCTGGAAATCTGTTATGTGTCTGTCACCCTCCCCAGGATTCTGGTGAATCTTTGG
ACTCAGGACAGAAGCATTTCTTGGTTGGGCTGTGCCACTCAAATGTGCTTCTTCCTCATG
CTGGGAGCCACTGAATGTTTCCTCTTGGCAGTGATGGCCTATGACCGCTACGTGGCCATT
TGTAACCCTCTGCACTACCCTCTCATCATGAACCACAAGATGTGCGTCCAACTGGCTGTT
GGTGCCTGGCTTAGTGGAATTCCAGTCCAGATAGGACAAACATGTCAGGTGTTCTCGCTG
CCTTTCTGTGGTTCTAACCAAATTAACCACTTCTTCTGTGACATCCCCCCATTGATCAAG
CTGGCTTGTGGGGACACTTCACTTAATGAGATGTGTGTCTTTGTAGTTGCTATATTATTT
GTCATGATTCCTTTTCTATTTATACTTGGCTCTTATGTGAAAATCATTTCCACCATCCTA
AAGTTGTCCTCAGCCAGGGGCCGGTCTAAAGCCTTCTCCACCTGTTCTTCCCATATCATT
GTTGTGCTTTTATTCTTTGGATCGGCTACCATCACCTACTTAAGGCCCAAATCCAATCAT
TCTGCAAGAACTGACAAGATGCTCTCTCTTTTCTACACCATTGTGACTCCTATGTTTAAC
CCTCTGATATACAGTCTTAGGAACAAGGATGTGAAGACAGCACTGAAAAAATTATTACTC
AAGAAAACAGTG


Conceptual translation

MLNSLFSQMLPRDQTTEGNLSSVVAFVLLGFSDLPNIQGFLFGIFFLIYMSILIGNGLII
IITRVDSVLQTPMYFFIANFSSLEICYVSVTLPRILVNLWTQDRSISWLGCATQMCFFLM
LGATECFLLAVMAYDRYVAICNPLHYPLIMNHKMCVQLAVGAWLSGIPVQIGQTCQVFSL
PFCGSNQINHFFCDIPPLIKLACGDTSLNEMCVFVVAILFVMIPFLFILGSYVKIISTIL
KLSSARGRSKAFSTCSSHIIVVLLFFGSATITYLRPKSNHSARTDKMLSLFYTIVTPMFN
PLIYSLRNKDVKTALKKLLLKKTV