Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Horse symbols

Horse OR10G7BP Olfactory Receptor

Gene Symbol OR10G7BP
Organism Horse
Family 10
Subfamily G
Pseudo Yes
Location chr7:31305211-31306143 (+)
Aliases LOC100071866

Sequence information


Nucleotide sequence

AATGGCAAACTTGAGCCTCGTGACAACATTCATCCTCATGGGCCTTCCCCACACAGCACC
ACTGGACACCCTTCTCTTTGGAATCTTCTTGGTGATTTATGTGTTCACTGTGGTGGGGAA
CTTGCTCATCCTGCTGGTGATCCTGGTAGATTCCCACCTCCACACCCCCATGTACTACTT
CCTGACCAACTTGTCCTTCATTGACATGTGGTTCTCCACAGTCACTGTGCCCAAAATGCT
GATGACTTTGGCCTCCCCAGGCGGCAAGGCTATCTCCTTCCACAGCTGTGTGGCCCAGCT
CTACTCCTTCCACTTTCTGGGGAGCACCGAGTGTTTCCTCTACACTGTCATGTCCTATGA
CCGCTACCTGGCCATCAGTTACCCACTCAGGTACAGCAGCATGATGAGTGGGAGAATGTG
TGCCCTCCTGGCCACAACACGTGGCTCAGTGGCTCTCTGCACTCTGCTTTCCAGACCGTA
TTGACATTCCGTTTGCCCTACTGTGGGTCCAACCAGATCCAGCATTACTTCTGTGATGCA
CCGCCCATCCTCAACCTGGCCTGTGCAGACACCTCTGCCAATGAGATGGTGATCTTTGTC
AATATCGGGGTAGTGGCTTCAGGCTGCTTTCTCCTGATGGTGTTGTCCTATGTGTCCATT
GTCTGTTCCATCCTGAAGATCCGCACCTCAGAGGGGAGACACAGAGCCTTTCAGACCTGT
GCCTCTCACTGCACTGTGGTCTTTTGTTTCTTTGGCCCTGGTGTTTTCATTTACCTGAGG
CCAGGCTCTAAGGATGCTGTGGACGGAGTTGTGGCAGTTTTCTACACAGTGCTGACACCT
CTTCTAAACCCTATGGTGTACACCCTGAGGAACAAAGAAGTGAAGAAATCTCTGCTCAAG
CTGAAAAGTAAATCAATATTCACTCACAGTAAA


Conceptual translation

MANLSLVTTFILMGLPHTAPLDTLLFGIFLVIYVFTVVGNLLILLVILVDSHLHTPMYYF
LTNLSFIDMWFSTVTVPKMLMTLASPGGKAISFHSCVAQLYSFHFLGSTECFLYTVMSYD
RYLAISYPLRYSSMMSGRMCALL/HNTWLSGSLHSAFQTVLTFRLPYCGSNQIQHYFCD
APPILNLACADTSANEMVIFVNIGVVASGCFLLMVLSYVSIVCSILKIRTSEGRHRAFQT
CASHCTVVFCFFGPGVFIYLRPGSKDAVDGVVAVFYTVLTPLLNPMVYTLRNKEVKKSLL
KLKSKSIFTHSK