Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Horse symbols

Horse OR10H33P Olfactory Receptor

Gene Symbol OR10H33P
Organism Horse
Family 10
Subfamily H
Pseudo Yes
Location chrUn:30441296-30442235 (+)

Sequence information


Nucleotide sequence

ACATTTTCTCTGGGTGGAGCTTGCTGAGGAAGATCTTCCTCATGGCGATCTTCAGCTCCT
TGTTCCTGAGGCTGAAGATGATGGGGCTGAGGAAGGGCGTGAGGACCGTGTAGGTGACGC
CCATCAGGGTGTCTCCTTCCAGAGACTGGGGACTCTTGGACCTGAGGTAGATGACAGAGG
CAAAGCTGTAGTGCACGACCACCACAGTGAGGTGGGACGCACACGTGGAGAAGGCCTTGT
GCCGGCCCTCAGCTGAGGGCATCCTCAAGATGGTGGGCACGATGAAGGCATAGGAGAGCA
GGATGAGGAGACAGCAGCCCAGCAGGACTGTGATGCAGAGCAGGCCCACACCCTTGCCAC
CCGTGGTACATCAGCTCCACAGGCCAACTTCAACAGTGTTGGCATGTGGCAAGCAAAATG
GTGGACCTCATTTGGTCCACAGAAGATGAGGTGGAAAATGGCCATTGTCACCACCATCCC
CATGACTGAGCCACCAGCCCAGGACCAGGCCACTAGGCAGGCACATCTACCAGGCCTCAT
GAGCACACTATAGCGCAGAGGGTGGCAGATGGCCACGTAGTGGTCATAGCCCATGACGGT
GAGCAGGAAGGAGTGGGTGAACCCGAAAGTGAAGGAGAAGAACATCTGGCTGGCACAGGC
TGTGAAGGTGATGGAGTGGACGGTGGAGAGCAGGTCAGCCAGCATTCGTGGGATGATGGT
GAAGGTGTAGAGGATCTCGGAGATGGAGAGAGTGCACAGGAAGAGGTACATGGGTGTGTG
GAGGCTGCGCTCAGGTGGTGGCCATGATGAGCAGGTTCCCCAGCAGCATGAACAGGTGCA
TCAGGAGGAACAGCAGGAAGAACACCAGCTGGAGGTGGGGGAAAGTGGAGAAGCCGATAA
GGATGAACTCGCTCACTGCTGAGAGGTTGGCTCCCTGCAT


Conceptual translation

MQGANLSAVSEFILIGFSTFPHLQLVFFLLFLLMHLFMLLGNLLIMATT*A\LHTPMYL
FLCTLSISEILYTFTIIPRMLADLLSTVHSITFTACASQMFFSFTFGFTHSFLLTVMGYD
HYVAICHPLRYSVLMRPGRCACLVAWSWAGGSVMGMVVTMAIFHLIFCGPNEVHHFACHM
PTLLKLAC/S*CTTGGKGVGLLCITVLLGCCLLILLSYAFIVPTILRMPSAEGRHKAFS
TCASHLTVVVVHYSFASVIYLRSKSPQSLEGDTLMGVTYTVLTPFLSPIIFSLRNKELKI
AMRKIFLSKLHPEKM