Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR10Q1 Olfactory Receptor

Gene Symbol OR10Q1
Organism Dog
Family 10
Subfamily Q
Pseudo No
Location chr18:38,127,300-38,128,300 (+)
Aliases cOR10Q1

Sequence information


Nucleotide sequence

ATGTTCGCTAGGAGCCCTGTCCTCAACCAATCCGGCCCCCCTGAGTTCTTCTTCCGCGTG
TTGACCACCGTCCCAGAATTCCAGGCCCTGCTCTTCCTCCTCTTCCTCCTCCTCTACTTG
ATGATCCTCTGTGGCAACACAGCCATCATCTGGGTGGTGTGCACGCACAGCTCCCTCCGC
ACCCCCATGTACTTCTTCCTCTGCAACCTGGCCTTCCTGGAAATCTGCTACACCACGGTG
GTGGTGCCTCTGATGCTTTCCAACATTTGGGGAGCCCCGAAGCCCATCCCCCTGGCTGGC
TGTGGGGCCCAGATGTTCTTTTTTGTCACCCTCGGCAGCACTGACTGCTTTCTCTTGGCA
ATCATGGCCTACGATCGCTATGTGGCCATCTGCCACCCGCTGCACTACACCCTCATCATG
ACCCAGAAGCTGTGCGCCCAGATGGTGGCGTGCGCGGTGGGCCTGGCCCTGGTCCTCTCC
CTGCAGCTCACGTCCTTAATCTTCACCCTGCCCTTCTGCGGGCACCGCCGGGAGATCAAC
CACTTCCTGTGCGATGTGCCCCCGGTCCTGCGGCTGGCCTGCGCCGACATCCGCGTGCAC
CAGGCGGTCCTCTACGTGGTGGGCATCCTCGTGCTGACCGTCCCCTTCCTGCTCATCTGT
GTGTCCTATGTGTTCATCGCCTCGGCCATCCTGCGCATCCGCTCCGCCGAGGGCCGCCGC
CGGGCCTTCTCCACCTGCTCCTCGCACCTCACCGTGGTCCTGCTGCAGTACGGCTGTTGC
AGCCTCGTCTACCTGCGGCCCCGCTCCAGCTCCTCGGTGGACGAGGACCGCCAGATCGCC
CTGGTCTACACCTTCGTCACCCCCCTCCTCAACCCGCTGATTTACACCCTCAGGAACAAG
GATGTCAAAGGTGCCCTGAGGAATGCCGTCCTCCATAAAGCAGCCTCTGGTGCCAGT


Conceptual translation

MFARSPVLNQSGPPEFFFRVLTTVPEFQALLFLLFLLLYLMILCGNTAIIWVVCTHSSLR
TPMYFFLCNLAFLEICYTTVVVPLMLSNIWGAPKPIPLAGCGAQMFFFVTLGSTDCFLLA
IMAYDRYVAICHPLHYTLIMTQKLCAQMVACAVGLALVLSLQLTSLIFTLPFCGHRREIN
HFLCDVPPVLRLACADIRVHQAVLYVVGILVLTVPFLLICVSYVFIASAILRIRSAEGRR
RAFSTCSSHLTVVLLQYGCCSLVYLRPRSSSSVDEDRQIALVYTFVTPLLNPLIYTLRNK
DVKGALRNAVLHKAASGAS