Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR10V1 Olfactory Receptor

Gene Symbol OR10V1
Organism Dog
Family 10
Subfamily V
Pseudo No
Location chr18:37071666-37072592 (+)
Aliases cOR10V6, cOR10V6

Sequence information


Nucleotide sequence

ATGGAAGAAATGAATAAAACTGCAAAGATACAGTTCTTCTTTCACCCATTCTCAGCTGAC
CCCAAGATCCAGGTGGGGATTTTTGTGGCCTTCCTGGTGATGTACCTGACCAGCCTCGGT
GGAAACACCACAATTGCAGTCCTTGTCCAGATCAACCCCTCCCTCCACATCCCCATGTAC
TTCTTCCTGGCTAACCTGGCAGTCCTGGAAATCTTCTATACCTCTGCCATTGCCCCACTG
GCTTTGGCAAACCTCCTTTCAATGGGCAAAACTCCTGTTTCTATCCCCGGATGTGGGGCC
CAGATGTTCTTCTTCATCTTCTTGGGTGGAGCTGACTGTGTCCTGCTGGCCGTCATGGCT
TACGACCGGTTTGTGGCAATCTGTTACCCTCTGAGATACACCCGCATCATGAGCTGGCCC
TTGTGTGTGGAGCTGATGGTCGGGTCCCTGGTGCTGGGGTTCCTGCTGTCGCTGCCGCTG
ACTATTTTAATCTTCCATCTCCCATTCTGTGGCCACAACGAGATCCACCACTTCTACTGT
GACATGCCTGCAGTCATGCGCCTGGCCTGCGCAGACACACACACTCACCAGACTGCCCTG
TACATCATCAGCTTCATCGTCCTGAGCGTCCCCCTGTCCTTAATCTCCACCTCCTACATC
TTCATCATGGCAGCCATTTTACGGATCCGGTCAGCAGAAGGGCGCCACCGAGCCTTCTCT
ACCTGTTCCTCCCACATCTTAGTGGTCCTCCTGCAGTATGGCTGCACCAGCTTTATCTAC
TTGTCCCCCCGGTCCAGCTACTCTCCTGAGATGGGCCGAGTGGTGTCTGTGGTCTACACT
TTCATCACTCCCATTTTAAACCCCTTGATCTACAGTATGAGGAACAGGGAACTGAAAGAT
GCCCTAAGGAGGGCACTGAGGAAGTTC


Conceptual translation

MEEMNKTAKIQFFFHPFSADPKIQVGIFVAFLVMYLTSLGGNTTIAVLVQINPSLHIPMY
FFLANLAVLEIFYTSAIAPLALANLLSMGKTPVSIPGCGAQMFFFIFLGGADCVLLAVMA
YDRFVAICYPLRYTRIMSWPLCVELMVGSLVLGFLLSLPLTILIFHLPFCGHNEIHHFYC
DMPAVMRLACADTHTHQTALYIISFIVLSVPLSLISTSYIFIMAAILRIRSAEGRHRAFS
TCSSHILVVLLQYGCTSFIYLSPRSSYSPEMGRVVSVVYTFITPILNPLIYSMRNRELKD
ALRRALRKF