Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR10V10 Olfactory Receptor

Gene Symbol OR10V10
Organism Dog
Family 10
Subfamily V
Pseudo No
Location chr18:37052457-37053482 (-)
Aliases cOR10Q3, cOR10Q3

Sequence information


Nucleotide sequence

ATGACTTCTTTCCTCATACCAGGTCTCATGGAAGAGGAAAACCAGACAGGAGTGGTCCAG
TTCCACTTCCACCCCTTCTCCACAGACCCAGCGGTGGTTCCCCTCCTATTTGTGGCCTTC
TTGCTGTTGTACTTAGGAAGTCTTGTTGGAAACATGACCATTGGGCTGACGGTCTGGAGA
GATCACTCCCTCCATACCCCGATGTACTTCTTCCTTTTTGTTCTGGCCGTGCTGGAGATC
GGCTACTCTACCAACATTGCTCCCCTGACTCTGGCTGGCATCCTTTCCATGGGGCGGATG
CTTATCTCTCTCCCTGGCTGTGGGGCCCAGATGTTCTTGTTCATCCTTCTTGGCGGGTCT
GACTGTGTCCTGCTTGCTGTCATGGCCTACGACAGGTACGTGGCAATCTGTCATCCGTTG
CACTACAACCTCATCATGAGTTGGGAGCTCTGTGGGCAGATGACTTTGGGCTCATTGGGG
CTGGGATTCCTGTTGTCACTGCCCTTGACCATTCTGATCTGCCACCTTCCATTCTGTGGC
CACAATGAGATCCACCACTTTTTCTGTGACATGCCTGCAGTCATGCGCCTGGCCTGCACA
GACACCCGCCTGCATGAAGCAACTCTCTATGCCCTCAGCGTGGTGGCTGTGGCTGTCCCC
TTCCTCCTCATCTGCCTCTCCTATGGCTGCATCGTGGCCACCATCCTGAGGATGAATTCA
GCTGAGGGAAAGCGCCGGGCTTTCTCCACCTGTTCCTCCCACCTTATCGTCGTTCTCCTG
CAATATGGGTGTTGCAGCCTCATCTACCTTCGCCCCAGCTCCAGCTACTCCCCAGAAGAG
GGCCGGGCAGTGTCCGTTGTCTACACCTTTTTCTCCCCAGTGCTAAACCCCTTGATCTAT
AGCATAAAGAATCAAGAGGTGACTGATGCAATAAGGAGACTTATGGCAAGAATGTGCTGG
GTCAGGAAACCAGAAATATTTCTTCCTAGAAAAAATATTCCCCAAACCAGGAATAAGGGC
ATGATG


Conceptual translation

MTSFLIPGLMEEENQTGVVQFHFHPFSTDPAVVPLLFVAFLLLYLGSLVGNMTIGLTVWR
DHSLHTPMYFFLFVLAVLEIGYSTNIAPLTLAGILSMGRMLISLPGCGAQMFLFILLGGS
DCVLLAVMAYDRYVAICHPLHYNLIMSWELCGQMTLGSLGLGFLLSLPLTILICHLPFCG
HNEIHHFFCDMPAVMRLACTDTRLHEATLYALSVVAVAVPFLLICLSYGCIVATILRMNS
AEGKRRAFSTCSSHLIVVLLQYGCCSLIYLRPSSSYSPEEGRAVSVVYTFFSPVLNPLIY
SIKNQEVTDAIRRLMARMCWVRKPEIFLPRKNIPQTRNKGMM