Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR10V4 Olfactory Receptor

Gene Symbol OR10V4
Organism Dog
Family 10
Subfamily V
Pseudo No
Location chr18:37099565-37100500 (+)
Aliases cOR10V4, cOR10V4

Sequence information


Nucleotide sequence

ATGGGGGATGAAAACCAAACCATAGACATCCAGTTCCACTTTCATCCATTTTCACCCATC
CTGGAGATACAAATACTTATTTTTGTGGCTTTCCTGCTAATGTATATTGGCAGTCTCACT
GGTAATGCCACAATCTTTCTCACTGTCTGGGCAGAGCGTTCACTCCACACTCCCATGTAT
TTCTTTCTGGCCAATCTGGCAGTTCTGGAGATCTTTTACTCTTCCACTGTTGCCCCTCTC
GCTTTGGTCAACCTCCTGACCATGGGGAGAATACCCATCTCTTTCGCTGGCTGTGGCACA
CAGATGTTCTTTTTTGTCTTTCTGGGCAGTGCTGACTGTATCCTCTTGGGGATCATGGCT
TATGATCGGTTTGTAGCTATTCGGAAGCCTCTGCGTTACACCCTCATCATGAGATGGCAG
CTGTGTGCCCAGCTGGCTCTGGGAGCCCTGGTCCTTGGTTTCATTCTAGCCTTACAACTA
ACAGCTCTGATTTTCCATCTGCCATTTTGTGGCCACAACAGAATCACTCACTTCTACTGT
GATGTACTCCCGATCTTGCAGCTGGCCTGTGGGGATACTCGAATGCAAGAAGCCATGATC
TTCATTGTCAGTGTCATCATCCTCACCATTCCCTTTTCTCTGATCTCCATCTCATACGTC
TTCATTGTGGGTGCCATTCTGAAGATCCGCTCTGCAGAGGGGCGGCACAAGGCCTTCTCC
ACCTGTTCTTCTCACCTGACTGTAGTTCTCCTCCAGTATGGCTGCTGTAGCCTTATCTAT
TTACGCCCCAGCTCTAGCTACAACCCAGAAATGGGCCGTGTGGTGTCTGTTGTCTACACT
TTTGTCACCCCTGTCTTGAACCCCTTGATCTACAGTATGAGGAACAAGGAGCTGAAAGAT
GCATTAAATAAGGTAATGAAAAGACATCTGCTCCAC


Conceptual translation

MGDENQTIDIQFHFHPFSPILEIQILIFVAFLLMYIGSLTGNATIFLTVWAERSLHTPMY
FFLANLAVLEIFYSSTVAPLALVNLLTMGRIPISFAGCGTQMFFFVFLGSADCILLGIMA
YDRFVAIRKPLRYTLIMRWQLCAQLALGALVLGFILALQLTALIFHLPFCGHNRITHFYC
DVLPILQLACGDTRMQEAMIFIVSVIILTIPFSLISISYVFIVGAILKIRSAEGRHKAFS
TCSSHLTVVLLQYGCCSLIYLRPSSSYNPEMGRVVSVVYTFVTPVLNPLIYSMRNKELKD
ALNKVMKRHLLH