Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR10V5 Olfactory Receptor

Gene Symbol OR10V5
Organism Dog
Family 10
Subfamily V
Pseudo No
Location chr18:37037166-37038191 (-)
Aliases cOR10V5, cOR10V5

Sequence information


Nucleotide sequence

ATGGGCCACCTGGCAGGAGCTCTGTATCCTGACCTTAATCTATCCTCAGGGGGAGCACGG
TGCCGTCAACAGGCCGCATGCACTGAATACATGGAGGGTGCTAATCAAACTGGGATGGTT
CGCTTCCACTTCCGCCCCTTCTCCAAACTCCCTGAGGTGCAGATGTTGATTTTTGTGGCC
TTCTTGATCATGTACCTGGTCAGCATCAGCGGCAATGTCTCCATTTCTCTCATCATCTGG
CTCAACCGTTCTCTGCACACCCCCATGTACTTCTTCCTGGCCAACTTGGCAGCTCTGGAG
ATCTGCTACTCTTCCACCATCGCCCCTCTGACCCTGGCCAGCGTCCTGTCCACAGAGAGA
GCCCTCATCTCCCTGCCTGGCTGTGGTACCCAGATGTTCTTCTTCATCTTCCTGGGCAGT
GCTGACTGTATTCTACTAGCTGTCATGGCCTATGACAGGTTTGTGGCCATCTGTCACCCT
TTGCGTTACACCCTCATGATGAGTTGGCGGTTGTGTGTGCAACTGGCCATGGGGTCTCTG
GTGCTGGGGTTCATCTTGGCCATGCAGTTGACTGTGCTCATCTTCCAACTCCCCTTCTGC
AGCAGTAAAGAAATCAGTCTGTTCTACTGTGATGTCCTCCCTGTCATGAGACTGGCCTGT
GCAGACACCTGGGTCCATGAGGCCACCCTCTTTGTGGTCAGCATCACCGTCCTCACTATC
CCCTTCCTGCTGATCACTCTCTCCTACGTCTTCATCGTGGCCGCCATCCTGAAGATTCGC
TCAGCAGAGGGGAGGCACAAGGCCTTCTCCACTTGCTCCTCTCACCTGACTGTGGTCCTG
CTGCAGTATGGATGTGGGAGCCTCATCTACCTGTGCCCCAGCTCCAGTTACTCTCCAGAG
AGGGGCCAGGTGGTGTCTGTGGTTTACACATTCATCACGCCTGTGCTGAACCCCTTGATC
TACAGCATGAGAAACAGGGAGCTTAAGGATGCTTTGAGGAGAACCATGATCAGGTTCCTG
TTGTCC


Conceptual translation

MGHLAGALYPDLNLSSGGARCRQQAACTEYMEGANQTGMVRFHFRPFSKLPEVQMLIFVA
FLIMYLVSISGNVSISLIIWLNRSLHTPMYFFLANLAALEICYSSTIAPLTLASVLSTER
ALISLPGCGTQMFFFIFLGSADCILLAVMAYDRFVAICHPLRYTLMMSWRLCVQLAMGSL
VLGFILAMQLTVLIFQLPFCSSKEISLFYCDVLPVMRLACADTWVHEATLFVVSITVLTI
PFLLITLSYVFIVAAILKIRSAEGRHKAFSTCSSHLTVVLLQYGCGSLIYLCPSSSYSPE
RGQVVSVVYTFITPVLNPLIYSMRNRELKDALRRTMIRFLLS