Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR13J1 Olfactory Receptor

Gene Symbol OR13J1
Organism Dog
Family 13
Subfamily J
Pseudo No
Location chr11:52399132-52400088 (-)
Aliases cOR13J2

Sequence information


Nucleotide sequence

ATGTCTCCTGAGCACTGCAATATGGAGTTGGTCAATAGGACAGAGATCTTTGAGTTCTTT
CTGAAAGGATTTTCTGGCTACCCAGCCCTGGAGCACCTGCTCTTCCCTCTGTGCTCAGCC
ATGTACCTGGTGACCCTGCTGGGGAACACAGCCATCGTGGCAGTGAGTGTCCTCGATGTC
CACCTACACACGCCCATGTACTTCTTCCTGGGCAACCTCTCCATCCTGGACATCTGCTAC
ACATCTACCTTTGTGCCTCTGATGCTGGTCCACCTCCTGTCAGCCCAGAAGACCATCTCT
TTTGTTGGCTGTGCAATCCAGATGTGTCTGAGCCTAGCCACAGGCTCCACAGAGTGTCTA
CTTCTTGCCATCATGGCCTACGATCGCTACCTGGCCATTTGCCGGCCACTCAGGTATCCC
GTGCTCATGAGCCACCGGCTCTGCTTGTTGCTGGCAGGAGCCGCCTGGGGACTCTGTCTT
GTCAAGTCAATGACTGAGACTGTCATTGCCATGAGGTTGCCTTTCTGTGGCCACCGCATG
GTTAGTCACTTCACCTGTGAGATCCTGGCAGTGCTGAAGCTGGCATGCAGTGACACATCA
GTCAGTGAAGTCTTCCTGCTGGTGGGTGCCATTCTGCTGCTGCCTATACCCCTGGCATTC
ATCTGCCTGTCCTACACACTTATCCTGGCCACCATCCTGAGAGTGCCCTCAGCAGCTGGG
CGTCGCAAAGCCTTCTCCACCTGCTCAGCACACCTGGCTGTGGTGATGCTGTTCTACGGC
ACCGTCATATTCATGTACATGAAACCCAAGAGCAAGGAGGCCCACATCTCTGATGAGGTC
TTCACAGTCCTCTATGCTGTTGTCACACCTATGCTGAACCCTGTCATCTACAGCTTGAGG
AACAAGGAGGTAAAGGAGGCTGCCAGGAAAGTATGGTGTAGGAGTTGGACATCCAAG


Conceptual translation

MSPEHCNMELVNRTEIFEFFLKGFSGYPALEHLLFPLCSAMYLVTLLGNTAIVAVSVLDV
HLHTPMYFFLGNLSILDICYTSTFVPLMLVHLLSAQKTISFVGCAIQMCLSLATGSTECL
LLAIMAYDRYLAICRPLRYPVLMSHRLCLLLAGAAWGLCLVKSMTETVIAMRLPFCGHRM
VSHFTCEILAVLKLACSDTSVSEVFLLVGAILLLPIPLAFICLSYTLILATILRVPSAAG
RRKAFSTCSAHLAVVMLFYGTVIFMYMKPKSKEAHISDEVFTVLYAVVTPMLNPVIYSLR
NKEVKEAARKVWCRSWTSK