Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR1D12P Olfactory Receptor

Gene Symbol OR1D12P
Organism Dog
Family 1
Subfamily D
Pseudo Yes
Location chr9:47093669-47094609 (-)
Aliases cOR1D12P

Sequence information


Nucleotide sequence

ATGGATGGAGGCAACCACATTGAAGTCTCTGAATTCCTACTCTTGGGGATCTCAGTTCTG
AGCAACAACAGGTCCAGTTCTGGATGTTCCTGTCCAGGTCCCTGGTTACAGGGGTGGGAA
ATGTGTTCATCATCCTGGCCATTGGCTCTGATCCCTGCCTGCACACTCCTATGTACTCCC
TCCTGGCCAACTTCTCCTTCACAGACCTCTTCTTTGTCACCAATACAATACCCAAGATGC
TGGCAAACCTTCAGTCTCAGAACAAAGCCATCTCCTATGCAGGGTGCCTAACACAGCTCT
ACTTCTTGGTCTCCCTGGTGACACTGGACAACCTCATTCTGGCCACAATGGCATATGACC
ACTATGTGGCCATCTGCCGCCCCCTCCACTATGTCACAGCCATGAGCCCTGGACTCTCTA
TTTTGTTCCTCACCTTGTGTTGGGCACTTTCTGTCATCTGTGGCCTTACCCACACCCTCC
TTCTGACCAGAGTGACCTTCTTTGGTTCCTGGAAGATCCGCTACATCTTCTGTGAGATGT
GTGTCATGCTAAGGTTGGCCTATTCCAACACCCAGAGCATTCACATACTGCTGATTACCA
CAGGCATCTTTATCTTCCTGACCCCCTTAGGGTTTGTGATCATGTCCTATGTCCACACTG
TCAAAGCCATCCTCTGAATGCCCTCAGCCTCTAGCAAGTACTAAGCCTTCTCCACTTGTG
CCCCCCCCCCCAATTTGGCTGTAGTCTCCCTCTTCTATGGGACACTTGGTATGGTATATC
TGCAGCCCCTCCACACCTACTCCATGAAGGACTCAGTAGCCACAATGATGTATGCTGTGG
TGACCCCCATGATGAACCCTTTCATCTACAGCCTGAAGAACAAGGACATGCATGGGGCTC
TGGGAAGACTGTTCCTAGGGAAAGCCTTCCAGAGGTTGACA


Conceptual translation

MDGGNHIEVSEFLLLGISV/EQQQVQFWMFLSRSLVTGVGNVFIILAIGSDPCLHTPMY
SLLANFSFTDLFFVTNTIPKMLANLQSQNKAISYAGCLTQLYFLVSLVTLDNLILATMAY
DHYVAICRPLHYVTAMSPGLSILFLTLCWALSVICGLTHTLLLTRVTFFGSWKIRYIFCE
MCVMLRLAYSNTQSIHILLITTGIFIFLTPLGFVIMSYVHTVKAIL*MPSASSKY*AFST
CAPPPNLAVVSLFYGTLGMVYLQPLHTYSMKDSVATMMYAVVTPMMNPFIYSLKNKDMHG
ALGRLFLGKAFQRLT