Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR1S1P Olfactory Receptor

Gene Symbol OR1S1P
Organism Dog
Family 1
Subfamily S
Pseudo Yes
Location chr18:38141622-38142556 (+)
Aliases cOR1S3P, cOR1S3P

Sequence information


Nucleotide sequence

ATGCATCAAGGAAATCGAACCACCATCTCTGGGTTCCTCCTTCTGGGACTCTCCAGCCAG
GCTGAGCACCAAAAGCTTCTCTTTGTGCTTTTCCTAGGTATGTACCTGGTCACTGTGGTC
GGGAATGGGCTCATCATTCTGGCCATTGGCTTGGATTCTTACCTTCACACTCCCATGTAT
CTTTTCCTTGCCAATCTGTCCTTTGCTGATATTTCCTCCATATCCACCTCAGTCCCCTAG
ATGCTGATGAATATTCAGACCAAAACTCAATCTATCTCCTATGAAAGTTGCATCACACAG
ATGTACTTTTCTATTGTGTTTGTTGTTAATGACAATTCCTCTGAGGAGTCATGGCCTATG
ACCGCTTTGTGGCTATCTGCCACCCTCTGAACTATGTGACCCTCATGCAACCCAGAATCT
GCGTTTTGCTCACAGTCATTCCGTGGGTCCTCAGTAACGTGGTCGCCCTAACACACACCC
TTCTGCTCATTCCATTGCTCTTCTGTGACAGCAACATTCTCCCACACTTCTTCTGTGACT
TGGCTCCTCTGCTCAAACTGTCCTGCTCAGACACAAGTATCAATGAACTCATGTTGTTTA
TCGTGGGCTCATCAGTTGTCACCTTCCCCTTTGCCTTAATTCTCTTCTCCTACATCTGCA
TTGTCAAGGCTATCCTGAGAATCTCATCCATGGAGGGAAAACGGAAAGCCTTCACCACCT
GTGGCTCTCATTTGACTGTTGTATTACTCTTCTATGGGACCATTATAGGGGTTTACTTCT
TCCCCTCATCCACTCACCCTGATGACAGAGATAAGATTGGTGCAGTGCTCTTCACTGTGG
TGACACCCATGATAAACCCCTTCATCTATAGCCTGAGGAACAAGGACATGAAAGTTGCCC
TAAGAAAGCTCATTAATAGAAAACATTCCTGTCTT


Conceptual translation

MHQGNRTTISGFLLLGLSSQAEHQKLLFVLFLGMYLVTVVGNGLIILAIGLDSYLHTPMY
LFLANLSFADISSISTSVP*MLMNIQTKTQSISYESCITQMYFSIVFVVND/FL*GVMA
YDRFVAICHPLNYVTLMQPRICVLLTVIPWVLSNVVALTHTLLLIPLLFCDSNILPHFFC
DLAPLLKLSCSDTSINELMLFIVGSSVVTFPFALILFSYICIVKAILRISSMEGKRKAFT
TCGSHLTVVLLFYGTIIGVYFFPSSTHPDDRDKIGAVLFTVVTPMINPFIYSLRNKDMKV
ALRKLINRKHSCL