Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR2A12 Olfactory Receptor

Gene Symbol OR2A12
Organism Dog
Family 2
Subfamily A
Pseudo No
Location chr16:5809672-5810601 (-)
Aliases cOR2A38, cOR2A36

Sequence information


Nucleotide sequence

ATGGGAAGCAATCAGACATGGATCACAGAAGTCATCCTGCTGGGATTCCAGGTTGATCCC
AAACTTGAAATATTCCTCTTTGGGTTCTTCTTGCTATTCTATAGCCTTACCTTGATGGGG
AACGGGCTCATCCTGGGGCTCATCTGGCTGGACTCCAGACTGCACACGCCCATGTACTTC
TTCCTCTCAAACCTGGCCATTGTTGACATGTCCTATGCCTCAAGCATTGTCCCTAAGATG
CTGGCAAGTCTTATAATGCAGAAGAAAACCATCTCCTTTGTTCCATGCATACTTCAGACA
TTTTTGTATTTGGCACTTGCTGTCACAGAGTGTATGAGTTTGGTGGTCATGTCCTATGAT
CGGTATGTGGCCATCTGCCATCCCCTACATTACACTGTCGTCATGAGCTGGAGAGTGTGC
ATTATCTTGTCTGCCACTTGCTGGATGTTCAGCTTTCTCTTGGCTCTGGTCCACATTACT
CTGATTCTTAAGTTGCCTTTTTGTGGACCACAAAAAATCAACCACTTTTTCTGTCAAATC
ATGTCGGTATTTAAATTGGCCTGTGCTGACACTAGACTCAACCAAATTGTTCTCTTTGCC
GGCTCTGTGTTTGTTTTAGTCGCACCCCTCTGCTTGGTGCTGGTATCCTATATTCATATC
CTGTTGGCCATCTTGAGGATCCAGTCTGGGGAGGGTCGCAGAAAGGCCTTCTCCACCTGC
TCCTCCCACCTCTGTGTGGTGGGGCTCTTCTTTGGCAGTGCTATTGTTATGTACCTGGCC
CCTAAATCTAGCCATTCTCAAGAACAAAGAAAGATTTTATCATTGTTTTATAGCCTTTTC
AATCCTATGCTAAACCCACTGATCAACAGCCTGAGGAACACTGAGGTGAAGAGTGCCCTG
AGGAGATTTCTAGGGAAGAAGTCATCAGCA


Conceptual translation

MGSNQTWITEVILLGFQVDPKLEIFLFGFFLLFYSLTLMGNGLILGLIWLDSRLHTPMYF
FLSNLAIVDMSYASSIVPKMLASLIMQKKTISFVPCILQTFLYLALAVTECMSLVVMSYD
RYVAICHPLHYTVVMSWRVCIILSATCWMFSFLLALVHITLILKLPFCGPQKINHFFCQI
MSVFKLACADTRLNQIVLFAGSVFVLVAPLCLVLVSYIHILLAILRIQSGEGRRKAFSTC
SSHLCVVGLFFGSAIVMYLAPKSSHSQEQRKILSLFYSLFNPMLNPLINSLRNTEVKSAL
RRFLGKKSSA