Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR2AH1 Olfactory Receptor

Gene Symbol OR2AH1
Organism Dog
Family 2
Subfamily AH
Pseudo No
Location chr18:39275079-39276008 (-)
Aliases cOR13R2, cOR13R2

Sequence information


Nucleotide sequence

ATGGATATGATAAAAACAAACTTCACTGTGACTGAGTTTGTGTTCTTGGGGCTGTCATCT
CAGCCAAAGATGCAGCTCATTCTTTTTATTATGTTCTTGTTCTTCTATTTATTAACAGTT
GTGGGGAATATTATAATTATCACTATTATCCAGATAGAACCTCGTCTCCAAACCCCCATG
TACTTCTTCCTTACTAATTTATCCTTTCTGGACATCTGCTACACATCCACCAATGTCCCA
CAAATGCTGTCCAACATGATGGGAAAAAAGACCATCCCCTTCTCTAGCTGTGCTACTCAG
ATGTACTTCTCCCTCTCCTTTGGAATGATTGAATGTGTTCTCCTTGGGGTCATGGCTTAT
GACAGATATGTAGCCATTTGTCATCCTCTCCATTATACTGTCATTATGAACCAAAGCATC
TGTGTCCAATTGGCAGCCATTTCTTGGTCCAGTAGCTTCCTGAGTTCCATGGTTATCAAT
GTCCTCACCTTGAGTTTGCCCTACTGTGGGCCCAATGTCCTGAATCACTTTTTTTGTGAG
GTTCCTTCTGTCTTGAGGTTAGCTTGCACTGACACCTCATTTACAGAGCTGGTTGTCTTT
ATCTTCAGTATCATCATTGTCTTCATCCCTTTTCTCCTCATTGTTGTTTCCTATGCCCGA
ATCCTTCTATCAGTTCTCAGGATACGGTCAGCCTCCGGGAGGCACAAAGCACTATCCACT
TGTGCCTCCCATCTGACAGTGGTGGCCTTATTCTATGGAACTGCCATCTTTATGTACATG
AGACCCCAGTCGAAGTCCTCCAGGGCTGGGGGCAAGATCATTGCAGTGTTCTACACTGTG
ATCACACCCATGCTCAACCCCTTGATCTATAGCCTAAGGAACCAGGATGTGAAAGGCGCT
TTAAGGAGAGCTATTGCAAAACGGAGGACA


Conceptual translation

MDMIKTNFTVTEFVFLGLSSQPKMQLILFIMFLFFYLLTVVGNIIIITIIQIEPRLQTPM
YFFLTNLSFLDICYTSTNVPQMLSNMMGKKTIPFSSCATQMYFSLSFGMIECVLLGVMAY
DRYVAICHPLHYTVIMNQSICVQLAAISWSSSFLSSMVINVLTLSLPYCGPNVLNHFFCE
VPSVLRLACTDTSFTELVVFIFSIIIVFIPFLLIVVSYARILLSVLRIRSASGRHKALST
CASHLTVVALFYGTAIFMYMRPQSKSSRAGGKIIAVFYTVITPMLNPLIYSLRNQDVKGA
LRRAIAKRRT