Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR2AT8P Olfactory Receptor

Gene Symbol OR2AT8P
Organism Dog
Family 2
Subfamily AT
Pseudo Yes
Location chr21:23415864-23416552 (+)

Sequence information


Nucleotide sequence

ATCAAAAGACTTTCAACCATCTTCTACTTCCTCAGCTTCCCTGCCTGCTTCCTTCAGATG
TACCTCTTCTACAGCTTCCCCTGCTCTGAAGCCTTCATCCTGGTGGTCATGGCCTATGAC
CGCTATGTGGCTATCTGCCACCCACTGCATACCCTGTCCTCATGACCCTACAGACCAATG
CTACACTGGCAGCCTGTGCCTGGCTCACTGCCCTCCTCCTGCCCATTCCAGCAGTGGTGC
AGACTTCCCACTTGGCTTTTGACAGCACTGCTCACATCTATCACTGCTTCTGTGACCACT
TGGCCATGGTCCAGGCCTCCTGCTCCATGCCCGAGACCCTCATGGGCTTCTGCATTGCCA
TGGTGGTATCCTTCCTGCCCCTTCTCCTGGTGCTTCTCTCCTATGCCCACATCCTGGCCT
CGGTGCTTCGCATCAGCTCCTGAGAAGGATGTTCAAAAGCCTTCTCCACCTGTAGCTCCC
ACTTCCTGGTAGTTGGCACATACTGCTCATCCATTGCCATAGCCTATGTGGCCTACAGGG
CTGACCTGCTCCTTGACCTCCACATCATGGGTGATGTGGTATTTGCCATTCTCACACCTG
TCCTCAACCCTGTCGTCTACATGCTGAGGAACAAGGATGTCAGTACCCATCACCAGAATG
GCATGTCCCCAGGACCCAGGGCATTCTGG


Conceptual translation

M\KRLSTIFYFLSFPACFLQMYLFYSFPCSEAFILVVMAYDRYVAICHPL/YPVLMTL
QTNATLAACAWLTALLLPIPAVVQTSHLAFDSTAHIYHCFCDHLAMVQASCSMPETLMGF
CIAMVVSFLPLLLVLLSYAHILASVLRISS*EGCSKAFSTCSSHFLVVGTYCSSIAIAYV
AYRADLLLDLHIMGDVVFAILTPVLNPVVYMLRNKDVSTHHQNGMSPGPRAFW