Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4A2 Olfactory Receptor

Gene Symbol OR4A2
Organism Dog
Family 4
Subfamily A
Pseudo No
Location chr18:41088250-41089164 (-)
Aliases cOR4A26, cOR4A26

Sequence information


Nucleotide sequence

ATGGAACACAGGAACAATGTGACTGAGTTTGTCCTCTTGGGGCTCACCCAGAGCATCCAA
GGTCAGAAAATATTATTTGTTGTGTTCTTGCTCATCTACATCGTGACAATGGTGGGCAAC
CTACTCATTGTGGTAACTGTGGTGGTCAGCCCAAGCCTGGATGCCCCTATGTACTTCTTT
CTTGGTTACTTATCATTTATGGATGCTGTGTATTCTACTACAGTTACTCCAAATATGATC
ATAGACTTACTCTATGAGAAGAAAACCATTTCCTTCCAAGCTTGCATGTCCCAGCTCTTT
ATAGGGCACTTATTTGGTGGTGCTGAGATTTTACTCCTGGTGGTCATGGCCTATGACCGC
TACGTGGCCATCTGCAAACCCTTGCATTATTTGACGATCATGAATCAACGAGTGTGTGTT
CTGTTGCTGTTGTTGGCTTGGTTTGGAGGGTTTTTGCATGCTGTGGTTAAACTTTTCTCC
ATTTACAACCTTCCTTTCTGTGGTCCCAATGTCATCGACCACTTCATCTGTGACATGTAC
CCATTACTAAAACTTGCCTGCACTGACACTTATGTTATTGGCCTCACTGTGGTTGCCAAT
GATGGGACTATCTGTGTCGTTATCTTTTTGGTCCTACTCATCTCCTACGGAGTCATTCTG
TACACCCTGAAGGCTCTTAGTCAGGAAGGGAGGCGCAAAGCCTTATCCACCTGTGGGTCC
CATATTACAGTGGTGGTCCTCTTCTTTGTCCCCTGCATTTTTATGTATGTGAGACCTCCT
TCTACCTTACCCATTGATAAATTCTTGACTGTGTTTTACACAGTTATCACCCCTATGTTA
AACCCCCTAATCTATACTCTGAGAAATGGAGAGATGAAAAATGCCATGAAAAAGTTGTGG
ACCAGAAGAAGAAAA


Conceptual translation

MEHRNNVTEFVLLGLTQSIQGQKILFVVFLLIYIVTMVGNLLIVVTVVVSPSLDAPMYFF
LGYLSFMDAVYSTTVTPNMIIDLLYEKKTISFQACMSQLFIGHLFGGAEILLLVVMAYDR
YVAICKPLHYLTIMNQRVCVLLLLLAWFGGFLHAVVKLFSIYNLPFCGPNVIDHFICDMY
PLLKLACTDTYVIGLTVVANDGTICVVIFLVLLISYGVILYTLKALSQEGRRKALSTCGS
HITVVVLFFVPCIFMYVRPPSTLPIDKFLTVFYTVITPMLNPLIYTLRNGEMKNAMKKLW
TRRRK