Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4A27 Olfactory Receptor

Gene Symbol OR4A27
Organism Dog
Family 4
Subfamily A
Pseudo No
Location chr18:40269773-40270699 (-)
Aliases cOR4A27P, cOR4A27P

Sequence information


Nucleotide sequence

ATGGAAAATCAGAACAATGTCACAGAATTTGTTTTCATGGGGCTATGGGGAAATAAGCAA
CTAGAACTACTGTTCTTTTTCTTGTTCCTGCTCTGCTACCTGGCTGTCTTAATGGGAAAC
TTCATTATCTTACTCACGATCACCTGCAGCCATCTAATTGAACATCCGATGTACTATTTT
CTCTGTCACCTTTCCCTCATGGACCTCTGCTACACCTCCACTGTGGTCCCCAGGCTAATC
AGGGACTTAGGTGCAGCAAGAAAAAACATTTCCTATAACAACTGTATGACCCAGCTCTTC
ACTGCCCACTTGCTGGCAGGGGTGGAGATATTCATCTTGGTGTCCATGGCTTTAGACCGC
TATGTTGCCATTGTCAAGCCCCTGCATTACATGGTCATCATGAACCGACGGAGGTGTAAC
CTGTTGATTTTTATGGCCTGGGGTGTGGGGTTTTGGCACTCTGTTGCTCTATTGCTCATG
GTACTCAATTTACCTTTCTGTGGTCCTAATCAGATAGATCATTACATATGTGATGTGAAG
CCTCTTTTGAAACTGGTGTGCAGAGATATTCGTGTTGTTAGTATCTTAGTGATTGCAAAC
TCAGGAATGGTGGTGGTTGTCATTTTTCTTGTCCTGGTGGCTTCTTACATTCTCATATTA
TATAATCTTAGGACCCACTCCTCTGTAGGGAGACTCAAAGCTCTCTCCACGTGCAGCTCT
CATGTAATGGTGGTCATTTTATTCTTTGTGCCTTGTATCTATACTTATGTTCTACCTGCA
GGGAGTGAGAACAAGGATAAGGAAATCTCTGTGTTTTACACTGTAATTGCTCCCATGCTG
AATCCTCTCATCTATACCTTAAGAAACATGGAGATGAAAATCGCCATGCGGAAGGTGTGG
TCTAAAGTGGCACATTCAGAATTCAAA


Conceptual translation

MENQNNVTEFVFMGLWGNKQLELLFFFLFLLCYLAVLMGNFIILLTITCSHLIEHPMYYF
LCHLSLMDLCYTSTVVPRLIRDLGAARKNISYNNCMTQLFTAHLLAGVEIFILVSMALDR
YVAIVKPLHYMVIMNRRRCNLLIFMAWGVGFWHSVALLLMVLNLPFCGPNQIDHYICDVK
PLLKLVCRDIRVVSILVIANSGMVVVVIFLVLVASYILILYNLRTHSSVGRLKALSTCSS
HVMVVILFFVPCIYTYVLPAGSENKDKEISVFYTVIAPMLNPLIYTLRNMEMKIAMRKVW
SKVAHSEFK