Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4A33 Olfactory Receptor

Gene Symbol OR4A33
Organism Dog
Family 4
Subfamily A
Pseudo No
Location chrUn_JH373563:11674-12600 (+)
Aliases cOR4A33, cOR4A33

Sequence information


Conceptual translation

MENQSNVTEFVFMGLWGNKQVELLFFLLFLLCYLAILMGNFIILLTIIHSHLIEQPMYYF
LCHLSLMDLCYTSTVVPRLIRDLGAARKNISYNNCMTQLFTAHLLAGVEIFILVSMALDR
YVAIVKPLHYMVIMNRRRCNLLIFMAWGVGFWHSVALLLLVLNLPFCGPNQIDHYICDVK
PLLKLVCRDIRVVNILVISNAGMVVVAVFLVLVASYILILYNLKTHSSVGRRKALSTCSS
HVMVVILFFVPCIYIYVLPAGSENKDKEISVFYTVIAPLLNPLIYTLRNVEMRNAMWKMW
SKMAHTKFR