Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4A47 Olfactory Receptor

Gene Symbol OR4A47
Organism Dog
Family 4
Subfamily A
Pseudo No
Location chr18:41100905-41101831 (-)
Aliases cOR4A29, cOR4A29, cOR4A30

Sequence information


Nucleotide sequence

ATGGAACCAAGAAACAATGTAACTTACTTTGTCCTCCTGGGCCTCACACAGGATCCTAAG
GAACAGAAGGTCCTTTTTATTATGTTCTTGCTCTTCTATATTTTGACTGTGGTGGGCAAC
CTGCTCATTGTGGTGACTGTAACTGTCAGTAAGACCCTGGGCTCACCTATGTACTTTTTT
CTTGCTAACTTATCTTTTATGGATGTCATTTATTCCTCTTGCATTTCCCCTAGATTGATT
TCAGAGTTTTTCTTTCAAAAAAGTACCATATCCTTCCAATCCTGTATGACTCAGCTCTTT
ATAGATCACCTTTTTGGTGGATCAGAGGTCTTTCTTCTTTTGGTGATGGCCTATGACCGC
TATGTGGCCATCTGTAAGCCTTTGCATTATTTGGTTATCATGAGGCAATGGGTATGTGTT
GTGCTGCTTGTGGTATCCTGGGTTGGAGGATTTCTGCATTCAGTAATTCAAGTGAGCACT
ATTTATGGGCTCCCATTCTGTGGCCCCAATGTCATAGATCATTTTTTCTGTGATATGTAC
CCCTTACTGAAACTGGTCTGTACTGAAACGTATGTTGCTGGCCTCTTAGTTGCTGCCAAT
GGAGGGGTGATATGCTCTATTGTGTTTGTGCTCTTGCTCATTTCTTATGGTGTCATCTTG
CACTCTCTAAAGAACCTTAGTCCAGAGGGGAGGCGGAAAGCCCTCCAGACCTGTGGTTCC
CATATCACTGTAGTGGTCTTCTTCTTTGTTCCATGTATTTTCATGTATGCAAGACCTGCT
AAGACCTTCCCCATTGACAAATCATTGACTGTGTTTTATACAGTCATAACCCCCATGCTA
AACCCACTGATCTACACCCTGAGAAATTCTGAGATGATAAATGCTATGAAGAAGCTTTGG
AGGAGAAATGTCATATCAAGTAGTCAA


Conceptual translation

MEPRNNVTYFVLLGLTQDPKEQKVLFIMFLLFYILTVVGNLLIVVTVTVSKTLGSPMYFF
LANLSFMDVIYSSCISPRLISEFFFQKSTISFQSCMTQLFIDHLFGGSEVFLLLVMAYDR
YVAICKPLHYLVIMRQWVCVVLLVVSWVGGFLHSVIQVSTIYGLPFCGPNVIDHFFCDMY
PLLKLVCTETYVAGLLVAANGGVICSIVFVLLLISYGVILHSLKNLSPEGRRKALQTCGS
HITVVVFFFVPCIFMYARPAKTFPIDKSLTVFYTVITPMLNPLIYTLRNSEMINAMKKLW
RRNVISSSQ