Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4A47B Olfactory Receptor

Gene Symbol OR4A47B
Organism Dog
Family 4
Subfamily A
Pseudo No
Location chr18:41123151-41124212 (-)
Aliases cOR4A34, cOR4A34

Sequence information


Nucleotide sequence

ATGGAACCAAGAAACAACGTAACTTACTTTGTCCTCTTGGGCCTCACACAGGATCCTAAG
GAACAGAAGGTCCTTTGTTTTATGTTCTTGCTCTTCTATATTTTGACAGTGGTGGGCAAC
TTGCTCATTGTGTTGACTATAGCTCTCAGTAAGACCCTGGGCTCACCTATGTACTTGTTT
CTTGCTAACCTATCATTTATGGATGTCACTTATTCCTCTTGCATTTCCCCCAGATTGATT
TCAACCTTGTTCTTTGGGGAAAATACCATATCCTTCCATTCTTGTATGACACAGTTATTT
ATGGAGCACCTTTTTGGTGGATCAGAGGTCTTTCTTCTGCTGGTGATGGCCTATGACCGC
TATGTGGCCATCTGTAAGCCTTTGCATTATTTGGTTATCATGAGGCAATGGGTGTGTGTT
GTGCTGCTGGTGGTATCCTGGATTGGAGGTTTTCTGCATTCAGTAATTCAAGTTAGCACC
ATTTATGGGCTCCCATTTTGTGGTCCCAATGTCATTGATCATTTTTCCTGTGACATGTAC
CCCTTACTAGAATTGGTCTGCACTAGCACCCATGTCATTGGGCTGTTAGTTGTAGCCAAT
GGAGGGATGATCTGCACTATTGTGTTTGTGTTCTTGCTCATCTCTTATGGTGTCATCTTG
CACTCTCTAAAGAACCTTAGTCCAGAGGGGAAGCGGAAAGCCCTCCAGACCTGTGGCTCC
CACATCACTGTGGTGGTCTTCTTCTTTGTTCCATGTATTTTCATGTATGCAAGACCTGCT
AAGACCTTCTACATTGACAAATCCTTGAGTGTGTTTTATACAGTCATAACCCCCATGCTG
AACCCACTGATCTACACTCTGAGAAATTCTGAGATGACAAATGCTATAAAGAAGCTCTGG
GGATCCCTGGGTGGCGCAGCGGTTTGGCGCCTGCCTTTGGCCCAGGGCGCGATCCTGGAG
ACCAGGGATCGAATCCCACATCGGGCTCCCGGTGCATGGAGCCTGCTTCTCCCTCTGCCT
GTGTCTCTGCCTCTCTCTCTCTCACTGTGTGCCTATCATAAA


Conceptual translation

MEPRNNVTYFVLLGLTQDPKEQKVLCFMFLLFYILTVVGNLLIVLTIALSKTLGSPMYLF
LANLSFMDVTYSSCISPRLISTLFFGENTISFHSCMTQLFMEHLFGGSEVFLLLVMAYDR
YVAICKPLHYLVIMRQWVCVVLLVVSWIGGFLHSVIQVSTIYGLPFCGPNVIDHFSCDMY
PLLELVCTSTHVIGLLVVANGGMICTIVFVFLLISYGVILHSLKNLSPEGKRKALQTCGS
HITVVVFFFVPCIFMYARPAKTFYIDKSLSVFYTVITPMLNPLIYTLRNSEMTNAIKKLW
GSLGGAAVWRLPLAQGAILETRDRIPHRAPGAWSLLLPLPVSLPLSLSLCAYHK