Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4A47C Olfactory Receptor

Gene Symbol OR4A47C
Organism Dog
Family 4
Subfamily A
Pseudo No
Location chr18:41152682-41153617 (-)
Aliases cOR4A55, cOR4A55

Sequence information


Nucleotide sequence

ATGCAGAAGATGGAACTAAGAAACAATGTAACTTACTTTGTCCTCTTGGGCCTCACACAG
AATCCAAAGGAACAGAAGGTCCTTTTTGTTATATTCTTGCTCTTCTATATTTTGACTGTG
GTGGGCAACTTGCTCATTTTGGTGACTATATCTCTCAGTAAGACCCTGGGCTCACCTATG
TACTTGTTTCTTGCTAACTTATCATTTATGGATGTCATTTATTCATCTTCTATATCCCCT
AGATTGATTTCAGACTTATTCTTTGCGAAAAATACCATATCGTTCCATTCTTGTATGATT
CAGCTCTTTACAGAGCACCTTTTTGGTGGAACAGAAATATTTCTTCTGCTGGTGATGGCC
TATGACCGCTATGTGGCCATCTGTAAGCCCTTGCATTATTTGGTTATCATGAAGCAATGG
GTGTGTGTTGTGCTGCTGGTGGTATCCTGGGTTGGAGGTTTTCTGCACTCAGTAATTCAA
CTTAGCACTATTCATGGGCTCCCATTCTGTGGGCCCAATGTCATCGATCATTTTTTCTGT
GACATGTACCCTTTACTGAAACTGGTCTGTACTGACACATATGTTATTGGGTTGTTAGTT
GTAGCCAATGGAGGGATGATCTGCACTATTGTGTTTTCATTCTTGCTCATCTCTTATGGT
ATCATCTTGCACTCTCTAAAGAACCTTAGTCCAGAGGGGAAGCGGAAAGCCCTCCAGACG
TGTGGCTCCCACATCACTGTGGTGGTCTTTTTCTTCGTTCCATGTATTTTCATGTATGCA
AGACCTGCTAAGACATTCCCCATTGACAAATCCCTGAGTGTGTTTTATACAGTCATAACC
CCAATGCTGAACCCGTTGATCTACACTTTGAGAAATTCTGAGATGACAAATGCTATGAAG
AAGCTATGGAGAAGAAATACTATATCTTTCAGTAGA


Conceptual translation

MQKMELRNNVTYFVLLGLTQNPKEQKVLFVIFLLFYILTVVGNLLILVTISLSKTLGSPM
YLFLANLSFMDVIYSSSISPRLISDLFFAKNTISFHSCMIQLFTEHLFGGTEIFLLLVMA
YDRYVAICKPLHYLVIMKQWVCVVLLVVSWVGGFLHSVIQLSTIHGLPFCGPNVIDHFFC
DMYPLLKLVCTDTYVIGLLVVANGGMICTIVFSFLLISYGIILHSLKNLSPEGKRKALQT
CGSHITVVVFFFVPCIFMYARPAKTFPIDKSLSVFYTVITPMLNPLIYTLRNSEMTNAMK
KLWRRNTISFSR