Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4A47EP Olfactory Receptor

Gene Symbol OR4A47EP
Organism Dog
Family 4
Subfamily A
Pseudo Yes
Location chr18:41,315,600-41,316,500 (-)
Aliases cOR4A4

Sequence information


Nucleotide sequence

ATGGAACCAAGGAGCAATGTAACTTACTTTGTCCTCTTGGGCCTCACACAGAATCCAAAG
GAACAGAAGGTCCTTTTTGTTATATTCTTGCTCTTGTATATTTTGACTGTGGTGGGCAAC
TTGCTCATTGTGGTGACTGTAACTGTCAGTAAGACCCTGAAGTCACCTATGTACTTTTTT
CTTGCTAGTTTATCATTTATTCCTCATCTATTTCTCCCAGATTGATTTCAGACTTGTTGT
TTGGGGAAAATACCATATCCTTTCAATCTTGTATGACTCAGCTATTAACAGAGCACTTTT
TTGGTGGATCAGAGGTCTTTCTTCTGCTGGTGATGGCCTATGACCGCTATGTGGCCATCT
GTAAGCCCTTGCATTATTTGGTTATCATGAGGCAATGGGTGTGTGTTGTGCTGCTTGTGG
TATCCTGGGTTGGAGGTTTTCTGCATTCAGTAATTCAACTTAGCACTATTTATGGGCTCC
CATTCTGTGGGCCCAATGTCATTGACCATTTTTTGTGTGACATGTACCCTTTATTGAAAC
TGGTCTGTACTGACACATATGTCATTGGGCTGTTAGTTGTAGCCAACGGAGGAGTGATCT
GCACTATTGTGTTTGTGCTCTTGCTCATCTCTTATGGTGTCATCTTGCACTCTCTAAAGA
ACCTTAGTCCAGAGGGGAAGCGGAAAGCCCTCCAGACCTGTGGCTCCCACATCACTGTGG
TGGTCTTCTTCTTTGTTCCATGTATTTTCATGTATGCAAGACCTGCTAAGACCTTCCCCA
TTGACAAATCCCTGAGTGTGTTTTATACAGTCATAACCCCCATGCTGAACCCACTGATCT
ATACTCTGAGAAATTCTGAGATGACAAATGCCATGAAGCAGctctggggaagaaacatca
tatctcttagtaaa


Conceptual translation

MEPRSNVTYFVLLGLTQNPKEQKVLFVIFLLLYILTVVGNLLIVVTVTVSKTLKSPMYFF
LASLS/YSSSISPRLISDLLFGENTISFQSCMTQLLTEHFFGGSEVFLLLVMAYDRYVA
ICKPLHYLVIMRQWVCVVLLVVSWVGGFLHSVIQLSTIYGLPFCGPNVIDHFLCDMYPLL
KLVCTDTYVIGLLVVANGGVICTIVFVLLLISYGVILHSLKNLSPEGKRKALQTCGSHIT
VVVFFFVPCIFMYARPAKTFPIDKSLSVFYTVITPMLNPLIYTLRNSEMTNAMKQLWGRN
IISLSK