Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4A47GP Olfactory Receptor

Gene Symbol OR4A47GP
Organism Dog
Family 4
Subfamily A
Pseudo Yes
Location chr18:41178197-41179123 (-)
Aliases cOR4A28, cOR4A28

Sequence information


Nucleotide sequence

ATGGAACCAAAGAACAATGTTACTGACTTTGTCCTCTTGGGCCTCACACAGAATCCAAAG
GAACAGAAGGTCCTTTTTGTTATATTCTTGCTCTTCTATATTTTGACCATGGTGGACAAC
CTACTCATTGTGGTGACTGTTTCTTTCAGTAAGACCCTGGGCTCACCTATGTACTTTTTT
CTTGCCAGCTTATCATTTATGGACGTCATTTATTCCTCTTCTATTTCTCCTGAACTGCTT
TCAAATTTGTTCTTTGGGGAAAATATCATATCCTTCCAATCTTGTATGATCCAGCTGTTT
ACAGAGCACTTTTTTGGTGGATCAGAGGTCTTTCTTCTGCTGGTGATGGCCTATGACCGC
TATGTGGCCATCTGTAAGCCCTTGCATTATTTGGTTATCATGAGGCAATGAGTATGTGTT
GTGCTGCTGGTGATATCCTGGGTTGGACGTTTTCTGCATTCAGTAATTAAAGTTAGCACT
ATTTAGAGGCTCCCATTCTGTGGCCCCAATGTCATCGATCATTTTTTCTGTGATATGTAC
CCCTTACTGAAACTGGTCTGTACTGACACCCATGTCATTGGCATCTTAGTTGCTGCCAAT
GGAAGGATGATCTGCACTATTGTGCTTGTGCTCGTGCTCATCTCTTATGGTGTCATCTTG
CACTCTCTAAAGAACCTTAGTTCAGAGGGGAGGCGGAAAGCCCTCCAGACCTGTGGTTCC
CATGTCACTGTGGTGGTCTTCTTCTTTGTTCCATGTATTTTCATGTATTTAAGACCTGCT
AAGACCTTCCCCCCTGACAAATCCCTGAGTGTGTTTTACACAGTCATAACCCCCATGCTG
AACCCACTGATCTACACTCTGAGAAATTCTGAGATGGCAAATGCTATGAAGAAGCTCTGG
AGCAGAAGTATCATATCTTGCAGCAAA


Conceptual translation

MEPKNNVTDFVLLGLTQNPKEQKVLFVIFLLFYILTMVDNLLIVVTVSFSKTLGSPMYFF
LASLSFMDVIYSSSISPELLSNLFFGENIISFQSCMIQLFTEHFFGGSEVFLLLVMAYDR
YVAICKPLHYLVIMRQ*VCVVLLVISWVGRFLHSVIKVSTI*RLPFCGPNVIDHFFCDMY
PLLKLVCTDTHVIGILVAANGRMICTIVLVLVLISYGVILHSLKNLSSEGRRKALQTCGS
HVTVVVFFFVPCIFMYLRPAKTFPPDKSLSVFYTVITPMLNPLIYTLRNSEMANAMKKLW
SRSIISCSK