Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4B1 Olfactory Receptor

Gene Symbol OR4B1
Organism Dog
Family 4
Subfamily B
Pseudo No
Location chr18:41477123-41478049 (-)
Aliases cOR4B1, cOR4B1

Sequence information


Nucleotide sequence

ATGGCGAATACAAGTAACGTGACTCAGTTAATTATCATTGGTCTTTTCCAGGATCCAGAG
GTTCAGAGAGTGTGTTTTGTGGTGTTTATTCTCGTGTACCTGGCCACAGTAGTTGGCAAT
GGCCTCATTGTCCTGACAGTCAATGTCAGTAAGAGTCTGCATTCCCCCATGTACTTCTTC
CTCAGCTACCTGTCCCTGGTGGAGATCACGTACTCCTCTACTGTTGTCCCTAAATTCATC
ACAGACTTACTTGCCAAGATTAAAACCATTTCCCTGGAGGGCTGTGTAGCTCAGATATTC
TTCTTCCACTTCTTTGGAGTCACTGAGATCTTCCTGCTTACGGTAATGGCCTATGACCGC
TATGTGGCCATCTGCAAACCCCTTCACTACACAACCATCATGAGCCGGTCTGTGTGTCGC
CTTCTGGTGGCTGGTTCCTGGCTTGGGGGCATAATTCACTCTATGGTCCAGATCCTTGTT
GCTGTTCAGCTGCCCTTCTGTGGTCCCAATGTGATTGACCACTACTTCTGTGACCTCCAT
CCCTTATTCAAGCTTGCCTGCACTGACACTTCTGTGGAGGGGGTTATTGTGTTGGCCAAC
AGTGGGTTAATCTCTGTTTTCTCCTTTCTTATCTTGGTATCCTCCTATATTGTCATCTTG
TTCAACTTGAGGAACCATTCTGCAGAGGGGAGGCGCAAAGCCCTCTCCACCTGTGCCTCT
CACATCACGGTGGTCCTTTTGTTCTTTGGACCTGCCATCTTTCTCTATATGCGACCCTCT
TCCACCTTCACTGAGGACAAACTGGTGGCCGTGTTCTACACAGTCGTCACTCCCATGCTG
AACCCCATCATCTACACACTCAGAAATGCAGAGGTCAAAAGTGCCATTAGGAAGCTGTGG
CGGAAGAAAGTGAACTCAGTAGTGGAA


Conceptual translation

MANTSNVTQLIIIGLFQDPEVQRVCFVVFILVYLATVVGNGLIVLTVNVSKSLHSPMYFF
LSYLSLVEITYSSTVVPKFITDLLAKIKTISLEGCVAQIFFFHFFGVTEIFLLTVMAYDR
YVAICKPLHYTTIMSRSVCRLLVAGSWLGGIIHSMVQILVAVQLPFCGPNVIDHYFCDLH
PLFKLACTDTSVEGVIVLANSGLISVFSFLILVSSYIVILFNLRNHSAEGRRKALSTCAS
HITVVLLFFGPAIFLYMRPSSTFTEDKLVAVFYTVVTPMLNPIIYTLRNAEVKSAIRKLW
RKKVNSVVE