Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4B1F Olfactory Receptor

Gene Symbol OR4B1F
Organism Dog
Family 4
Subfamily B
Pseudo No
Location chr18:41535359-41536285 (-)
Aliases cOR4B4, cOR4B4

Sequence information


Nucleotide sequence

ATGGCGAATACAAATAACGTGACTGAGTTAATTATCATTGGTCTTTTCCAGGATCCAGAG
GTGCAGAGAGTGTGTTTTGTGATATTTCTTCTCGTGTACCTGGCCACGGTGGTGGGCAAT
GGCCTCATTGTCCTGACAGTCAATGTCAGTAAGAGTTTGCATTCCCCCATGTACTTTTTC
CTCAGCTACCTGTCCCTGGTGGAGATCACGTACTCTTCTACTGTTGTCCCTAAATTCATC
ACAGACTTACTTGCCAAGATTAAAACCATTTCCCTGGAGGGCTGTGTAGCTCAGATATTC
TTCTTCCACTTCTTTGGAGTCACTGAGATCTTCCTGCTTACGGTAATGGCCTATGACCGC
TATGTGGCCATCTGCAAACCCCTTCACTACACAACCATCATGAGCCGGTCTGTGTGTTGC
CTTCTGGTGGCTGGTTCCTGGATTGGTGGCTTTTTTCACTCCATGGTTCAGATTATTATT
ACACTCCAGTTGTCTTTCTGTGGTCCCAATGTGATTGACCACTACTTCTGTGACCTCCAT
CCCTTATTCAAGCTTGCCTGCACTGACACTTCTGTGGAGGGGGTTATTGTGTTGGCCAAC
AGTGGGTTATTTTCTATCTTTTCCTTCCTCCTCCTAGTGTCCTCCTATATTGTCATCCTG
TTCAACTTGAGGAACCATTCTGCAGAGGGGAGGCGCAAAGCCCTCTCCACCTGTGCCTCT
CATATCATGGTGGTCCTTTTGTTCTTTGGACCTGCCATCTTTCTCTACATGCGACCTCCG
TCCACCTTCACTGAGGACAAACTGGTGGCCGTGTTCTACACGGTTGTCACTCCCATGCTG
AACCCCATCATCTACACACTCAGAAATGCAGAGGTGAAAAATGCCATGAGGAAGCTGTGG
GGGAAGAAAGTGAACTCTGGGATGGGA


Conceptual translation

MANTNNVTELIIIGLFQDPEVQRVCFVIFLLVYLATVVGNGLIVLTVNVSKSLHSPMYFF
LSYLSLVEITYSSTVVPKFITDLLAKIKTISLEGCVAQIFFFHFFGVTEIFLLTVMAYDR
YVAICKPLHYTTIMSRSVCCLLVAGSWIGGFFHSMVQIIITLQLSFCGPNVIDHYFCDLH
PLFKLACTDTSVEGVIVLANSGLFSIFSFLLLVSSYIVILFNLRNHSAEGRRKALSTCAS
HIMVVLLFFGPAIFLYMRPPSTFTEDKLVAVFYTVVTPMLNPIIYTLRNAEVKNAMRKLW
GKKVNSGMG