Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4C10D Olfactory Receptor

Gene Symbol OR4C10D
Organism Dog
Family 4
Subfamily C
Pseudo No
Location chr18:40,499,400-40,500,400 (+)
Aliases cOR4C55, cOR4C39

Sequence information


Nucleotide sequence

ATGGAGATTAGGAACAACGTGACAGAATTTGTGCTACTGGGGCTCACAGAGAATCCAAAG
ATGCAGAAAATCATATTTGTTGTGTTTCTGGTCATCTACATCGTCTCTGTGGTAGGAAAT
GTGCTCACCGTGGTCACTATCACTGCCAGCCCATTATCGGGGTCCCCCATGTACTTTTTC
CTGGCCTATCTCTCCCTCATTGATGCCTGCTATTCTTCTGTCAATACCCCCACCCTCATC
ATAGAGTCACTCCGTGAAAAGAAGACCATCCCATTCAATGCATGCATAATCCAAATCTTT
GGGGAACATTTCTTTGGAGGTGCTGATGTCATCCTGCTTACTGTGATGGCCTATGACCGC
TATGTGGCCATCTGCAAGCCACTGCACTACATGACCATCATGAATCGGCGGCTATGTGGC
CTGCTCATGGCAGTGGTGTGGGTGGGAGGCTTTCTTCATGCAGCCATACAGATCCTCTTT
ATCATCCCACTACCCTTCTGTGGCCCTAACGTCATAGATCACTTTATATGTGATCTGAAT
CCTTTGCTCAATCTTGCCTGCACTGATACCCACACTCTTGGGTTCTTTGTTGCTGCCAAC
AGTGGTTTCATCTGTGTCTTAAACTTCCTCCTCCTCATGGTTTCCTATGTGGTCATTCTG
CGCTCCCTAAAGAACCACAGCTTGGAGGCGAGGCGCAAAGCCCTCTCCACCTGTGTCTCT
CACATCACAGTGGTCGTCCTATTCTTTGTGCCCTGCATATTTGTGTACATGAGACCCGCA
GCTACTTTATCCATTGATAAAGCAGTTGCAGTGTTCTATACTACAATAACTCCCATGTTA
AATCCTTTAATCTATACCTTGAGAAATGACCAGATGAAAAATGCCATTAGGAAACTGTGT
AGTAGGAATGCTAGTGTGGGTGACAAA


Conceptual translation

MEIRNNVTEFVLLGLTENPKMQKIIFVVFLVIYIVSVVGNVLTVVTITASPLSGSPMYFF
LAYLSLIDACYSSVNTPTLIIESLREKKTIPFNACIIQIFGEHFFGGADVILLTVMAYDR
YVAICKPLHYMTIMNRRLCGLLMAVVWVGGFLHAAIQILFIIPLPFCGPNVIDHFICDLN
PLLNLACTDTHTLGFFVAANSGFICVLNFLLLMVSYVVILRSLKNHSLEARRKALSTCVS
HITVVVLFFVPCIFVYMRPAATLSIDKAVAVFYTTITPMLNPLIYTLRNDQMKNAIRKLC
SRNASVGDK