Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4C10E Olfactory Receptor

Gene Symbol OR4C10E
Organism Dog
Family 4
Subfamily C
Pseudo No
Location chr18:40415007-40415933 (+)
Aliases cOR4C60P, cOR4C60P

Sequence information


Nucleotide sequence

ATGGGGAATAGAAACAATGTGACAGAGTTTGTTCTACTGGGGCTCACAGAGAATCCAAAG
ATGCAGAAAATCGTTTTTGTTGTGTTTTTGATCATCTACATCATCTCTGTGGTAGGAAAT
GTGCTCACCGTGGCAGCTATCACCACCAGCCCATTATTGGGGTCCCCCATGTACTTTTTC
CTGGCCTATCTTTCCTTCATTGATGCCTGCTATTCTTCTGTCAATAACCCTAAACTGATT
GTAGATTCACTCCGTGAAAAGAAGACCACCACATTCAATGCATGTATAACCCAAATCTTT
GGGGAACATTTTTTTGGAGGTGCTGATGTCATCCTGCTTACTGTGATGGCCTATGACCGC
TATGTGGCCATCTGCAAGCCACTGCACTACATGACCATCATGAATCGGCAGGTGTGTGGC
TTGCTCATGGCAGTGGTGTGGGTGGGAGGCTTTCTTCATGCAGCCATACAGATCCTCTTT
ATCATCCCTCTACCCTTCTGTGGCCCTAACGTCATAGATCACTTTATGTGTGATCTGAAT
CCTATGCTCAATCTTGCCTGCACTGATACCCACACTCTTGGGTTCTTTGTTGCTGCCAAC
AGTGGTTTCATCTGTGCCTTAAACTTCCTCCTCCTCATGGTCTCCTATGTGGTCATTCTG
CGCTCCCTAAGGAACCACAGCTTGGAGGCGAAGCGCAAAGCCCTCTCCACCTGTGTCTCC
CACATCACAGTGGTCGTCCTATTCTTTGTGCCCTGCATATTTGTGTACATGAGACCCGCA
GCTACTTTACCTATTGATAAAGCAGTTGCAGTTTTCTACACTATGATAACACCCATGTTA
AATCCCTTAATCTATGCCTTGAGAAATGATCAGATGCAAAAAGCCATTAGGAAATTGTGC
AGTAGAAAAGTTATTTCAGATGAGAAA


Conceptual translation

MGNRNNVTEFVLLGLTENPKMQKIVFVVFLIIYIISVVGNVLTVAAITTSPLLGSPMYFF
LAYLSFIDACYSSVNNPKLIVDSLREKKTTTFNACITQIFGEHFFGGADVILLTVMAYDR
YVAICKPLHYMTIMNRQVCGLLMAVVWVGGFLHAAIQILFIIPLPFCGPNVIDHFMCDLN
PMLNLACTDTHTLGFFVAANSGFICALNFLLLMVSYVVILRSLRNHSLEAKRKALSTCVS
HITVVVLFFVPCIFVYMRPAATLPIDKAVAVFYTMITPMLNPLIYALRNDQMQKAIRKLC
SRKVISDEK