Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4C11E Olfactory Receptor

Gene Symbol OR4C11E
Organism Dog
Family 4
Subfamily C
Pseudo No
Location chr18:40341886-40342815 (+)
Aliases cOR4C20P, cOR4C20P

Sequence information


Nucleotide sequence

ATGCAGCAAAATAACAGCGTAACAGAGTTCATACTATTAGGACTAACCCAAGACCCTATC
AGACAGAAAATGATATTTGTAATCTTCTCCATTTTTTATGTGGGAACTGTGGTTGGGAAT
TTGCTTATTATTGTGACCATCAAGTCTAGCCGGACACTTGGGAGCCCCATGTACTTTTTC
CTATTTTATTTGTCCCTTGCTGATTCCTGCTTTTCAACTTCCACAGCCCCCAGACTAATT
GTGGATTCACTCTCTGCAAAAAAAATCATAACTTACAATGAGTGCATGACTCAAGTCTTT
GCACTACATTTATTTGGCTGCATGGAGATCTTTGTCCTCATCCTCATGGCCGTTGATCGC
TATGTGGCCATCTGTATGCCTTTACGTTACCCAACCATCATGAGACGGCAGGTCTGCACC
ATCCTAATTGTTCTGGCATGGATTGGATCTTTTATCCATTCTATAGCCCAGATTATCCTG
GCTTTGAGATTGCCCTTCTGTGGACCGAATTTGATTGATCATTACTGCTGTGATTTGCAG
CCCTTGCTGAAACTTGCTTGCATGGACACTTATAAGATCAACCTATTGTTGGTGTCTAAT
AGTGGGGCCATTTGCTCAAGCAGTTTTGTGATTCTGATGATCTCCTATATTGTCATCTTG
CATTCCCTGCGAAACCACAGTGCGGAAGGGAAGAAAAAAGCTCTCTCTACTTGTACTTCT
CACATCATTGTAGTAATCTTATTCTTTGGTCCATGTATATTCATTTATACACGCCCCCCA
ACTACTTTCCCCATGGACAAGATGGTGGCCGTATTTTATACTATTGGGACACCTTTTCTC
AATCCACTTATCTACACACTGAGGAATGCAGAAGTGAAAAATGCCATGAAAAAGCTATGG
CATATCAAAATTACCTCAGAAAGCAAAAAA


Conceptual translation

MQQNNSVTEFILLGLTQDPIRQKMIFVIFSIFYVGTVVGNLLIIVTIKSSRTLGSPMYFF
LFYLSLADSCFSTSTAPRLIVDSLSAKKIITYNECMTQVFALHLFGCMEIFVLILMAVDR
YVAICMPLRYPTIMRRQVCTILIVLAWIGSFIHSIAQIILALRLPFCGPNLIDHYCCDLQ
PLLKLACMDTYKINLLLVSNSGAICSSSFVILMISYIVILHSLRNHSAEGKKKALSTCTS
HIIVVILFFGPCIFIYTRPPTTFPMDKMVAVFYTIGTPFLNPLIYTLRNAEVKNAMKKLW
HIKITSESKK